Diaphorina citri psyllid: psy11599


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70------
MNIVGAWLGSEISFTGVVLSCTITRDFTYNKVMPTFHHWQTGNKKFGLTFQAAADARAFDQGVRNALQEYLHDKSL
ccEEccEEEEEEEccEEEEEEECccccEEECccccEEEEECccCEEEEEcccHHHHHHHHHHHHHHHHHHHccccc
*NIVGAWLGSEISFTGVVLSCTITRDFTYNKVMPTFHHWQTGNKKFGLTFQAAADARAFDQGVRNALQEYLH****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIVGAWLGSEISFTGVVLSCTITRDFTYNKVMPTFHHWQTGNKKFGLTFQAAADARAFDQGVRNALQEYLHDKSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sprouty-related, EVH1 domain-containing protein 1 Tyrosine kinase substrate that inhibits growth-factor-mediated activation of MAP kinase. Negatively regulates hematopoiesis of bone marrow.confidentQ7Z699
Sprouty-related, EVH1 domain-containing protein 1 Tyrosine kinase substrate that inhibits growth-factor-mediated activation of MAP kinase.confidentQ66JG9
Sprouty-related, EVH1 domain-containing protein 1 Tyrosine kinase substrate that inhibits growth-factor-mediated activation of MAP kinase. Negatively regulates hematopoiesis of bone marrow.confidentQ924S8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019220 [BP]regulation of phosphate metabolic processprobableGO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0003674 [MF]molecular_functionprobable
GO:0043086 [BP]negative regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0050789
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SYX, chain A
Confidence level:very confident
Coverage over the Query: 3-74
View the alignment between query and template
View the model in PyMOL