Diaphorina citri psyllid: psy11600

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------

MSHVQCMIGPSILNSDLSNLHSESQNLLDSGADYLHLDVMDGTFVPNLTFGHPVVKCLRNKIPKAFFETHMMVQNPQQWIEPMADANVDQYTFHVEPVDNVPQVIRQIKEAGMKVGQVLQDWIEPMADANVDQYTFHVEPVDNVPQVIRQIKEAGMKVGLAIKPKTPVDVIAEYIESADLVLIMTVEPGFGGQKFMQDMMPKVKWLRENYPTLNIEVDGGVGPNTIDECAKCLTGFGGQKFMQDMMPKVKWLRENYPTLNIEVDGGVGPNTIDECAK

cccccccECcHHHHHHHHcHHHHHHHHHHccccCEEEEcccccccccccccHHHHHHHHHcccccccEEEEccccccccHHHHHHccccEEEECccccccHHHHHHHHHHHcccccccccccccHHHHcccccEEEccccccccHHHHHHHHHHccEEEEEEcccccHHHHHHHHHcccEEEEECcccccccccccccHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHccccCCcccccHHHHHHHHHHHHHHHHHHHccccccccHHHHcc

****QCM*GPSILNSDLSNLHSESQNLLDSGADYLHLDVMDGTFVPNLTFGHPVVKCLRNKIPKAFFETHMMVQNPQQWIEPMADANVDQYTFHVEPVDNVPQVIRQIKEAGMKVGQVLQDWIEPMADANVDQYTFHVEPVDNVPQVIRQIKEAGMKVGLAIKPKTPVDVIAEYIESADLVLIMTVEPGFGGQKFMQDMMPKVKWLRENYPTLNIEVDGGVGPNTIDECAKCLTGFGGQKFMQDMMPKVKWLRENYPTLNIEVDGGVG*********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ribulose-phosphate 3-epimerase	Catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate.	confident	Q8VEE0
Ribulose-phosphate 3-epimerase	Catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate.	confident	Q96AT9
Ribulose-phosphate 3-epimerase	Catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate.	confident	Q5R5Y2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008198 [MF]	ferrous iron binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0005506, GO:0046872
GO:0048029 [MF]	monosaccharide binding	probable	GO:0003674, GO:0030246, GO:0005488
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004750 [MF]	ribulose-phosphate 3-epimerase activity	probable	GO:0016857, GO:0016854, GO:0003674, GO:0016853, GO:0003824
GO:0042802 [MF]	identical protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0009052 [BP]	pentose-phosphate shunt, non-oxidative branch	probable	GO:0019321, GO:0019320, GO:0006739, GO:0046365, GO:0006733, GO:0006732, GO:0034641, GO:0006098, GO:0046496, GO:0072524, GO:1901360, GO:0006139, GO:0044710, GO:0051186, GO:0071704, GO:0055086, GO:0046483, GO:0044281, GO:0006740, GO:0006725, GO:0009987, GO:0019318, GO:1901575, GO:0009117, GO:0008152, GO:0044723, GO:1901564, GO:0009056, GO:0055114, GO:0044724, GO:0044238, GO:0006753, GO:0005975, GO:0005996, GO:0016052, GO:0044237, GO:0006796, GO:0006807, GO:0006793, GO:0019637, GO:0008150, GO:0006006, GO:0006007, GO:0019362

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
5.-.-.-	Isomerases.	probable
5.1.-.-	Racemases and epimerases.	probable
5.1.3.-	Acting on carbohydrates and derivatives.	probable
5.1.3.1	Ribulose-phosphate 3-epimerase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OVP, chain A
Confidence level:very confident
Coverage over the Query: 5-99,143-254
View the alignment between query and template
View the model in PyMOL

Template: 1H1Y, chain A
Confidence level:very confident
Coverage over the Query: 64-153,175-222,234-276
View the alignment between query and template
View the model in PyMOL