Diaphorina citri psyllid: psy11609


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MALFIYVVSDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGCKIDVSPYHDVDFELEFR
cEEEEEEEEcccccccHHHHHHHcccEEEEEEEcccccEEEEEEEEcHHHHHHHHHHccccEEEccEEEEECccccccccccc
*ALFIYVVSDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGCKIDVSPYHD********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALFIYVVSDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGCKIDVSPYHDVDFELEFR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein split ends Probable corepressor protein, which regulates different key pathways such as the EGF receptor and Wg pathways. Involved in neuronal cell fate, survival and axon guidance, cell cycle regulation and repression of head identity in the embryonic trunk. May act with the Hox gene Deformed and the EGF receptor signaling pathway. Positive regulator of the Wg pathway in larval tissues but not in embryonic tissues. May act as a transcriptional corepressor protein, which repress transcription via the recruitment of large complexes containing histone deacetylase proteins.confidentQ8SX83
Msx2-interacting protein May serve as a nuclear matrix platform that organizes and integrates transcriptional responses. In osteoblasts, supports transcription activation: synergizes with RUNX2 to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE). Has also been shown to be an essential corepressor protein, which probably regulates different key pathways, such as the Notch pathway. Negative regulator of the Notch pathway via its interaction with RBPSUH, which prevents the association between NOTCH1 and RBPSUH, and therefore suppresses the transactivation activity of Notch signaling. Blocks the differentiation of precursor B-cells into marginal zone B-cells. Probably represses transcription via the recruitment of large complexes containing histone deacetylase proteins. May bind both to DNA and RNA.confidentQ62504
Msx2-interacting protein May serve as a nuclear matrix platform that organizes and integrates transcriptional responses. In osteoblasts, supports transcription activation: synergizes with RUNX2 to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE) (By similarity). Has also been shown to be an essential corepressor protein, which probably regulates different key pathways such as the Notch pathway. Negative regulator of the Notch pathway via its interaction with RBPSUH, which prevents the association between NOTCH1 and RBPSUH, and therefore suppresses the transactivation activity of Notch signaling. Blocks the differentiation of precursor B-cells into marginal zone B-cells. Probably represses transcription via the recruitment of large complexes containing histone deacetylase proteins. May bind both to DNA and RNA.confidentQ96T58

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008586 [BP]imaginal disc-derived wing vein morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0048106 [BP]establishment of thoracic bristle planar orientationprobableGO:0007164, GO:0048104, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0008407, GO:0048513, GO:0048729, GO:0032502, GO:0009887, GO:0032501, GO:0060429, GO:0009888, GO:0044767, GO:0022416, GO:0008150, GO:0001736, GO:0007423, GO:0044707, GO:0048856, GO:0001738, GO:0048731
GO:0003714 [MF]transcription corepressor activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0007173 [BP]epidermal growth factor receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699, GO:0038127
GO:0007379 [BP]segment specificationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0035282, GO:0007275, GO:0044699
GO:0016055 [BP]Wnt receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0030177 [BP]positive regulation of Wnt receptor signaling pathwayprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0030111, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0001085 [MF]RNA polymerase II transcription factor bindingprobableGO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0007422 [BP]peripheral nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0035222 [BP]wing disc pattern formationprobableGO:0032502, GO:0007389, GO:0032501, GO:0007447, GO:0044707, GO:0007444, GO:0048856, GO:0035220, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0007275, GO:0044699
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0050769 [BP]positive regulation of neurogenesisprobableGO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0008150, GO:0065007, GO:0010720, GO:0048518, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0051960, GO:2000026, GO:0048731, GO:0048522
GO:0008347 [BP]glial cell migrationprobableGO:0040011, GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048870, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0042063, GO:0006928, GO:0008150, GO:0051674, GO:0044763, GO:0007275, GO:0048731, GO:0022008, GO:0016477, GO:0051179, GO:0044699
GO:0003697 [MF]single-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0035321 [BP]maintenance of imaginal disc-derived wing hair orientationprobableGO:0048563, GO:0030030, GO:0060429, GO:0030154, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0035316, GO:0007275, GO:0044699, GO:0035315, GO:0007389, GO:0008544, GO:0007472, GO:0048869, GO:0007552, GO:0007476, GO:0016043, GO:0035317, GO:0048569, GO:0048513, GO:0071840, GO:0030855, GO:0032502, GO:0048707, GO:0009886, GO:0030182, GO:0009987, GO:0009888, GO:0035114, GO:0008150, GO:0003002, GO:0048731, GO:0022008, GO:0044767, GO:0048699, GO:0009954, GO:0007399, GO:0044707, GO:0007444, GO:0009913, GO:0048856, GO:0007560, GO:0044763, GO:0048736, GO:0048737
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0007403 [BP]glial cell fate determinationprobableGO:0032502, GO:0044707, GO:0045165, GO:0021781, GO:0007399, GO:0009987, GO:0048869, GO:0001709, GO:0042063, GO:0032501, GO:0044763, GO:0010001, GO:0048731, GO:0030154, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0007400 [BP]neuroblast fate determinationprobableGO:0030154, GO:0007275, GO:0044699, GO:0014016, GO:0048863, GO:0048865, GO:0048867, GO:0048869, GO:0001709, GO:0008150, GO:0032502, GO:0032501, GO:0009987, GO:0014017, GO:0044763, GO:0022008, GO:0048699, GO:0045165, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0017053 [CC]transcriptional repressor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0048749 [BP]compound eye developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0001191 [MF]RNA polymerase II transcription factor binding transcription factor activity involved in negative regulation of transcriptionprobableGO:0001076, GO:0003674, GO:0000989, GO:0000988
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FY1, chain A
Confidence level:very confident
Coverage over the Query: 2-78
View the alignment between query and template
View the model in PyMOL