Psyllid ID: psy11609


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MALFIYVVSDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGCKIDVSPYHDVDFELEFR
cEEEEEEEEccccccHHHHHHHHcccEEEEEEEcccccEEEEEEEEcHHHHHHHHHHccccEEEccEEEEEEccccccccccc
cEEEEEEEccccHHcccHHHEEccccEEEEEEEcccccEEEEEEEccHHHHHHHHHHccccEEEEEEEEEEcccccccccccc
MALFIYVVSdtslkdglyHEYKKHGKVSWVKIIGqggdryglvcfKKADDAEKAILGShekhffgckidvspyhdvdfelefr
MALFIYVVSDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGCKIDVSPYHDVDFELEFR
MALFIYVVSDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGCKIDVSPYHDVDFELEFR
**LFIYVVSDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGCKIDVSPYHDVDFE****
*ALFIYVVSDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKK*************KHFFGCKIDVS************
MALFIYVVSDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGCKIDVSPYHDVDFELEFR
MALFIYVVSDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGCKIDVSPYHD********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiii
oooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALFIYVVSDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGCKIDVSPYHDVDFELEFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query83 2.2.26 [Sep-21-2011]
Q8SX83 5560 Protein split ends OS=Dro yes N/A 0.903 0.013 0.710 4e-28
Q96T58 3664 Msx2-interacting protein yes N/A 0.903 0.020 0.506 1e-14
Q62504 3644 Msx2-interacting protein yes N/A 0.891 0.020 0.513 2e-14
>sp|Q8SX83|SPEN_DROME Protein split ends OS=Drosophila melanogaster GN=spen PE=1 SV=2 Back     alignment and function desciption
 Score =  123 bits (308), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 62/76 (81%), Gaps = 1/76 (1%)

Query: 9   SDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGCKI 68
           SDTSLKDGL+HEYKKHGKV+WVK++GQ  +RY LVCFKK DD EKA+  SH+KHFFGCKI
Sbjct: 566 SDTSLKDGLFHEYKKHGKVTWVKVVGQNSERYALVCFKKPDDVEKALEVSHDKHFFGCKI 625

Query: 69  DVSPYHDVDFE-LEFR 83
           +V PY   D E  EFR
Sbjct: 626 EVEPYQGYDVEDNEFR 641




Probable corepressor protein, which regulates different key pathways such as the EGF receptor and Wg pathways. Involved in neuronal cell fate, survival and axon guidance, cell cycle regulation and repression of head identity in the embryonic trunk. May act with the Hox gene Deformed and the EGF receptor signaling pathway. Positive regulator of the Wg pathway in larval tissues but not in embryonic tissues. May act as a transcriptional corepressor protein, which repress transcription via the recruitment of large complexes containing histone deacetylase proteins.
Drosophila melanogaster (taxid: 7227)
>sp|Q96T58|MINT_HUMAN Msx2-interacting protein OS=Homo sapiens GN=SPEN PE=1 SV=1 Back     alignment and function description
>sp|Q62504|MINT_MOUSE Msx2-interacting protein OS=Mus musculus GN=Spen PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query83
442624895 5510 split ends, isoform F [Drosophila melano 0.903 0.013 0.710 2e-26
442624890 5458 split ends, isoform H [Drosophila melano 0.903 0.013 0.710 2e-26
442624888 5487 split ends, isoform G [Drosophila melano 0.903 0.013 0.710 2e-26
6979936 5554 split ends long isoform [Drosophila mela 0.903 0.013 0.710 2e-26
6467825 5533 Spen RNP motif protein long isoform [Dro 0.903 0.013 0.710 2e-26
20151563 1521 LD15253p [Drosophila melanogaster] 0.903 0.049 0.710 2e-26
24580583 5476 split ends, isoform C [Drosophila melano 0.903 0.013 0.710 2e-26
24580581 5533 split ends, isoform B [Drosophila melano 0.903 0.013 0.710 2e-26
24580579 5560 split ends, isoform A [Drosophila melano 0.903 0.013 0.710 2e-26
386768866 5505 split ends, isoform D [Drosophila melano 0.903 0.013 0.710 2e-26
>gi|442624895|ref|NP_001259805.1| split ends, isoform F [Drosophila melanogaster] gi|440213051|gb|AGB92342.1| split ends, isoform F [Drosophila melanogaster] Back     alignment and taxonomy information
 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 62/76 (81%), Gaps = 1/76 (1%)

Query: 9   SDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGCKI 68
           SDTSLKDGL+HEYKKHGKV+WVK++GQ  +RY LVCFKK DD EKA+  SH+KHFFGCKI
Sbjct: 516 SDTSLKDGLFHEYKKHGKVTWVKVVGQNSERYALVCFKKPDDVEKALEVSHDKHFFGCKI 575

Query: 69  DVSPYHDVDFE-LEFR 83
           +V PY   D E  EFR
Sbjct: 576 EVEPYQGYDVEDNEFR 591




Source: Drosophila melanogaster

Species: Drosophila melanogaster

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|442624890|ref|NP_001259803.1| split ends, isoform H [Drosophila melanogaster] gi|440213049|gb|AGB92340.1| split ends, isoform H [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442624888|ref|NP_001259802.1| split ends, isoform G [Drosophila melanogaster] gi|440213048|gb|AGB92339.1| split ends, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|6979936|gb|AAF34661.1|AF221715_1 split ends long isoform [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|6467825|gb|AAF13218.1|AF188205_1 Spen RNP motif protein long isoform [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|20151563|gb|AAM11141.1| LD15253p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24580583|ref|NP_722616.1| split ends, isoform C [Drosophila melanogaster] gi|6715140|gb|AAF26299.1|AF184612_1 split ends [Drosophila melanogaster] gi|22945598|gb|AAN10511.1| split ends, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24580581|ref|NP_524718.2| split ends, isoform B [Drosophila melanogaster] gi|10727420|gb|AAF51534.2| split ends, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24580579|ref|NP_722615.1| split ends, isoform A [Drosophila melanogaster] gi|46397733|sp|Q8SX83.2|SPEN_DROME RecName: Full=Protein split ends gi|10727421|gb|AAF51535.2| split ends, isoform A [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|386768866|ref|NP_001245816.1| split ends, isoform D [Drosophila melanogaster] gi|442624893|ref|NP_001259804.1| split ends, isoform E [Drosophila melanogaster] gi|383291252|gb|AFH03493.1| split ends, isoform D [Drosophila melanogaster] gi|440213050|gb|AGB92341.1| split ends, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query83
FB|FBgn0016977 5560 spen "split ends" [Drosophila 0.903 0.013 0.710 1.4e-24
ZFIN|ZDB-GENE-050309-70 3476 spen "spen homolog, transcript 0.903 0.021 0.545 5e-15
UNIPROTKB|H0Y5U7 297 SPEN "Msx2-interacting protein 0.903 0.252 0.506 1.5e-14
UNIPROTKB|F1MB97 636 SPEN "Uncharacterized protein" 0.891 0.116 0.513 1.7e-13
UNIPROTKB|F6WRY4373 SPEN "Msx2-interacting protein 0.783 0.174 0.538 2.4e-13
UNIPROTKB|E1BV40 3586 Gga.17720 "Uncharacterized pro 0.903 0.020 0.506 8.8e-13
UNIPROTKB|E1C4T6 3607 Gga.17720 "Uncharacterized pro 0.903 0.020 0.506 8.9e-13
UNIPROTKB|F1Q262 3297 SPEN "Uncharacterized protein" 0.903 0.022 0.506 1e-12
RGD|2318836 3534 LOC100365546 "rCG30673-like" [ 0.903 0.021 0.506 1.1e-12
UNIPROTKB|F1LU10 3618 LOC100365546 "Protein LOC10036 0.903 0.020 0.506 1.1e-12
FB|FBgn0016977 spen "split ends" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 301 (111.0 bits), Expect = 1.4e-24, P = 1.4e-24
 Identities = 54/76 (71%), Positives = 62/76 (81%)

Query:     9 SDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGCKI 68
             SDTSLKDGL+HEYKKHGKV+WVK++GQ  +RY LVCFKK DD EKA+  SH+KHFFGCKI
Sbjct:   566 SDTSLKDGLFHEYKKHGKVTWVKVVGQNSERYALVCFKKPDDVEKALEVSHDKHFFGCKI 625

Query:    69 DVSPYHDVDFE-LEFR 83
             +V PY   D E  EFR
Sbjct:   626 EVEPYQGYDVEDNEFR 641




GO:0006355 "regulation of transcription, DNA-dependent" evidence=IMP
GO:0007379 "segment specification" evidence=IMP
GO:0005634 "nucleus" evidence=NAS;IDA
GO:0007411 "axon guidance" evidence=IMP
GO:0007400 "neuroblast fate determination" evidence=IMP
GO:0008347 "glial cell migration" evidence=IMP
GO:0007403 "glial cell fate determination" evidence=IMP
GO:0007173 "epidermal growth factor receptor signaling pathway" evidence=IMP
GO:0016055 "Wnt receptor signaling pathway" evidence=IMP
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0007422 "peripheral nervous system development" evidence=IMP
GO:0008586 "imaginal disc-derived wing vein morphogenesis" evidence=IMP
GO:0035321 "maintenance of imaginal disc-derived wing hair orientation" evidence=IMP
GO:0048106 "establishment of thoracic bristle planar orientation" evidence=IMP
GO:0035222 "wing disc pattern formation" evidence=IMP
GO:0030177 "positive regulation of Wnt receptor signaling pathway" evidence=IGI
GO:0048749 "compound eye development" evidence=IMP
ZFIN|ZDB-GENE-050309-70 spen "spen homolog, transcriptional regulator (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y5U7 SPEN "Msx2-interacting protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MB97 SPEN "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6WRY4 SPEN "Msx2-interacting protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BV40 Gga.17720 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4T6 Gga.17720 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q262 SPEN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|2318836 LOC100365546 "rCG30673-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LU10 LOC100365546 "Protein LOC100365546" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q62504MINT_MOUSENo assigned EC number0.51310.89150.0203yesN/A
Q8SX83SPEN_DROMENo assigned EC number0.71050.90360.0134yesN/A
Q96T58MINT_HUMANNo assigned EC number0.50640.90360.0204yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query83
cd1234974 cd12349, RRM2_SHARP, RNA recognition motif 2 in SM 5e-33
cd1230879 cd12308, RRM1_Spen, RNA recognition motif 1 in the 1e-07
cd1255378 cd12553, RRM1_RBM15, RNA recognition motif 1 in ve 2e-07
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-06
smart0036073 smart00360, RRM, RNA recognition motif 3e-05
pfam1389356 pfam13893, RRM_5, RNA recognition motif 4e-04
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 0.002
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 0.003
>gnl|CDD|240795 cd12349, RRM2_SHARP, RNA recognition motif 2 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
 Score =  108 bits (271), Expect = 5e-33
 Identities = 38/63 (60%), Positives = 50/63 (79%)

Query: 9  SDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGCKI 68
          SDTSLKDGL+HE+KKHGKV+ VK+ G G +RY +V F+K +DAEKA+  S  K FFG +I
Sbjct: 12 SDTSLKDGLFHEFKKHGKVTSVKVHGTGSERYAIVFFRKPEDAEKALEVSKGKLFFGAEI 71

Query: 69 DVS 71
          +V+
Sbjct: 72 EVT 74


This subfamily corresponds to the RRM2 of SHARP, also termed Msx2-interacting protein (MINT), or SPEN homolog, an estrogen-inducible transcriptional repressor that interacts directly with the nuclear receptor corepressor SMRT, histone deacetylases (HDACs) and components of the NuRD complex. SHARP recruits HDAC activity and binds to the steroid receptor RNA coactivator SRA through four conserved N-terminal RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), further suppressing SRA-potentiated steroid receptor transcription activity. Thus, SHARP has the capacity to modulate both liganded and nonliganded nuclear receptors. SHARP also has been identified as a component of transcriptional repression complexes in Notch/RBP-Jkappa signaling pathways. In addition to the N-terminal RRMs, SHARP possesses a C-terminal SPOC domain (Spen paralog and ortholog C-terminal domain), which is highly conserved among Spen proteins. . Length = 74

>gnl|CDD|240754 cd12308, RRM1_Spen, RNA recognition motif 1 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240997 cd12553, RRM1_RBM15, RNA recognition motif 1 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 83
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.81
KOG0107|consensus 195 99.8
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.79
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.77
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.75
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.73
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.71
PLN03120 260 nucleic acid binding protein; Provisional 99.69
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.69
KOG0113|consensus 335 99.67
smart0036272 RRM_2 RNA recognition motif. 99.66
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.66
COG0724 306 RNA-binding proteins (RRM domain) [General functio 99.66
KOG0148|consensus 321 99.66
PLN03121 243 nucleic acid binding protein; Provisional 99.66
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.65
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.65
smart0036170 RRM_1 RNA recognition motif. 99.64
KOG4207|consensus 256 99.64
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.62
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.62
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.61
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.6
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.6
PLN03213 759 repressor of silencing 3; Provisional 99.59
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.57
smart0036071 RRM RNA recognition motif. 99.56
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.56
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.56
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.55
KOG0125|consensus 376 99.54
KOG0123|consensus 369 99.51
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.5
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.48
KOG0111|consensus 298 99.48
KOG0149|consensus 247 99.48
KOG0123|consensus369 99.47
KOG1548|consensus382 99.43
KOG0117|consensus 506 99.39
KOG0114|consensus124 99.39
KOG0121|consensus153 99.39
KOG0122|consensus270 99.38
KOG0105|consensus 241 99.37
KOG0131|consensus 203 99.35
KOG0117|consensus 506 99.32
KOG0108|consensus 435 99.32
KOG0415|consensus 479 99.27
KOG0148|consensus321 99.26
KOG0145|consensus360 99.26
KOG0127|consensus 678 99.26
KOG0127|consensus 678 99.26
KOG0109|consensus 346 99.24
KOG0144|consensus 510 99.2
KOG0110|consensus 725 99.2
KOG0124|consensus 544 99.2
KOG0145|consensus 360 99.19
KOG0126|consensus219 99.17
KOG0130|consensus170 99.16
KOG0147|consensus 549 99.14
KOG0131|consensus203 99.13
KOG4206|consensus 221 99.11
KOG0109|consensus 346 99.07
KOG0153|consensus377 98.98
KOG0226|consensus290 98.96
KOG0132|consensus 894 98.92
KOG0144|consensus 510 98.89
KOG0106|consensus 216 98.88
KOG4661|consensus 940 98.85
KOG4205|consensus 311 98.85
KOG0146|consensus371 98.76
KOG0533|consensus243 98.67
KOG4209|consensus231 98.61
KOG0116|consensus419 98.6
KOG4205|consensus 311 98.59
KOG4208|consensus214 98.51
KOG1996|consensus378 98.5
KOG0151|consensus 877 98.48
KOG0147|consensus549 98.47
KOG2202|consensus 260 98.47
KOG1190|consensus 492 98.43
KOG4212|consensus608 98.39
KOG0146|consensus 371 98.38
KOG0120|consensus500 98.38
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.3
KOG4212|consensus 608 98.28
KOG0106|consensus216 98.26
KOG1457|consensus 284 98.25
KOG4454|consensus 267 98.24
KOG0124|consensus 544 98.22
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.21
KOG0110|consensus725 98.18
KOG1457|consensus284 98.12
KOG4660|consensus 549 97.97
KOG4210|consensus285 97.93
KOG0112|consensus 975 97.92
KOG1548|consensus 382 97.84
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.7
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.6
KOG2314|consensus 698 97.53
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.37
KOG1995|consensus 351 97.3
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.12
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.07
KOG1456|consensus 494 97.06
KOG1456|consensus 494 97.03
KOG0120|consensus 500 96.99
KOG0115|consensus 275 96.91
KOG0112|consensus 975 96.88
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 96.79
PF04847 184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 96.73
KOG4211|consensus 510 96.5
KOG2068|consensus 327 96.36
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.14
KOG1190|consensus 492 95.69
KOG0128|consensus 881 95.55
KOG0128|consensus881 94.96
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 94.94
KOG4676|consensus 479 94.49
KOG4285|consensus350 94.24
KOG1855|consensus 484 94.04
PF15023166 DUF4523: Protein of unknown function (DUF4523) 93.44
KOG2135|consensus526 93.37
KOG4206|consensus221 93.01
KOG4307|consensus944 92.69
KOG2193|consensus 584 92.35
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 92.31
KOG4210|consensus 285 92.15
KOG4211|consensus 510 91.86
KOG0129|consensus 520 91.01
PF02714 325 DUF221: Domain of unknown function DUF221; InterPr 90.63
KOG4307|consensus 944 89.17
KOG0129|consensus520 88.15
KOG4574|consensus 1007 87.86
KOG0105|consensus241 87.74
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 86.13
KOG4660|consensus549 83.99
KOG2253|consensus 668 80.21
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
Probab=99.81  E-value=1.7e-19  Score=133.15  Aligned_cols=74  Identities=27%  Similarity=0.340  Sum_probs=70.8

Q ss_pred             eEeeeecCCcchhhHHHHHhccCCceeEEEEeccC----CceEEEEEeCCchHHHHHHhhcCCceecCeeeEEEecCC
Q psy11609          2 ALFIYVVSDTSLKDGLYHEYKKHGKVSWVKIIGQG----GDRYGLVCFKKADDAEKAILGSHEKHFFGCKIDVSPYHD   75 (83)
Q Consensus         2 ~lfv~k~~d~~~~d~L~~eF~kfG~Itsv~V~~d~----~~g~afV~F~~pEdA~~A~~~~ng~~~~g~~i~V~~a~g   75 (83)
                      +|||++|+.++.+++|++.|++||+|.+|+|++|.    ++|||||.|.++|+|.+|+.+|||..|.||+|+|.....
T Consensus       271 ~lfV~NL~~~~~e~~L~~~F~~fG~v~~v~i~~d~~t~~skG~aFV~F~~~~~A~~Ai~~lnG~~~~gr~i~V~~~~~  348 (352)
T TIGR01661       271 CIFVYNLSPDTDETVLWQLFGPFGAVQNVKIIRDLTTNQCKGYGFVSMTNYDEAAMAILSLNGYTLGNRVLQVSFKTN  348 (352)
T ss_pred             EEEEeCCCCCCCHHHHHHHHHhCCCeEEEEEeEcCCCCCccceEEEEECCHHHHHHHHHHhCCCEECCeEEEEEEccC
Confidence            59999999999999999999999999999999987    699999999999999999999999999999999998764



These proteins contain 3 RNA-recognition motifs (rrm: pfam00076).

>KOG0107|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>PF02714 DUF221: Domain of unknown function DUF221; InterPro: IPR003864 This domain is found in a family of hypothetical transmembrane proteins none of which have any known function, the aligned region is at 538 residues at maximum length Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query83
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-07
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 7e-07
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 9e-07
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 1e-06
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 1e-05
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-05
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-05
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 2e-05
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 2e-05
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-05
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-05
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-05
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 3e-05
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 4e-05
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 4e-05
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-05
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 5e-05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 6e-05
1x4e_A85 RNA binding motif, single-stranded interacting pro 7e-05
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 7e-05
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 7e-05
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 7e-05
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 8e-05
2kt5_A124 RNA and export factor-binding protein 2; chaperone 8e-05
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 8e-05
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-04
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 1e-04
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-04
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 1e-04
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-04
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 2e-04
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-04
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-04
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-04
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 2e-04
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-04
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 2e-04
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 2e-04
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-04
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 3e-04
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-04
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 3e-04
1x5p_A97 Negative elongation factor E; structure genomics, 3e-04
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 3e-04
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 4e-04
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 4e-04
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 4e-04
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 5e-04
2f3j_A177 RNA and export factor binding protein 2; RRM domai 5e-04
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 6e-04
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 8e-04
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 9e-04
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
 Score = 46.0 bits (108), Expect = 1e-07
 Identities = 14/74 (18%), Positives = 27/74 (36%), Gaps = 7/74 (9%)

Query: 5  IYV------VSDTSLKDGLYHEYKKHGKVSWVKIIGQGGDR-YGLVCFKKADDAEKAILG 57
          IY+      +    LK  LY  + + G++  + +      R    V FK+   A  A+  
Sbjct: 12 IYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRS 71

Query: 58 SHEKHFFGCKIDVS 71
               F+   + + 
Sbjct: 72 MQGFPFYDKPMRIQ 85


>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query83
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.89
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.88
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.88
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.87
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.86
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.86
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.86
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.85
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.85
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.85
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.85
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.85
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.85
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.85
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.85
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.84
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.84
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.84
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.84
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.84
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.84
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.84
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.84
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.84
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.84
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.84
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.84
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.84
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.84
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.84
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.84
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.83
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.83
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.83
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.83
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.83
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.83
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.83
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.83
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.83
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.83
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.83
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.83
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.83
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.83
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.83
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.83
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.83
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.83
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.83
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.83
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.83
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.83
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.82
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.82
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.82
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.82
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.82
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.82
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.82
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.82
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.82
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.82
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.82
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.82
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.82
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.82
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.82
2div_A99 TRNA selenocysteine associated protein; structural 99.82
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.82
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.82
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.82
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.82
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.82
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.82
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.82
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.82
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.81
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.81
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.81
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.81
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.81
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.81
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.81
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.81
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.81
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.81
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.81
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.81
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.81
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.81
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.81
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.81
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.81
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.81
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.81
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.81
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.81
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.81
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.81
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.81
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.81
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.81
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.81
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.8
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.8
1x5p_A97 Negative elongation factor E; structure genomics, 99.8
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.8
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.8
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.8
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.8
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.8
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.8
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.8
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.8
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.8
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.79
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.79
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.79
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.79
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.79
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.79
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.79
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.79
2dis_A109 Unnamed protein product; structural genomics, RRM 99.79
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.79
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.79
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.79
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.79
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.79
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.79
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.79
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.79
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.79
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.78
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.78
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.78
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.78
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.78
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.78
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.78
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.78
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.78
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.78
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.78
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.78
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.78
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.78
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.78
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.77
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.77
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.77
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.77
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.77
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.77
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.77
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.77
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.77
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.76
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.76
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.76
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.76
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.76
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.75
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.75
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.75
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.61
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.75
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.74
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.74
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.74
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.74
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 99.74
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.74
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.74
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.73
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 99.73
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.73
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.72
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.72
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.72
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.72
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.72
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.72
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.71
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.71
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.71
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.7
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.7
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.69
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.69
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.68
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.68
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.68
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.68
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.67
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.66
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.66
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.66
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.65
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.65
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.64
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.63
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.63
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.63
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.5
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.36
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.35
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.4
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.01
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 97.69
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.65
2i2y_A150 Fusion protein consists of immunoglobin G- binding 97.43
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 97.42
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.8
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 96.69
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.65
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.51
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 93.47
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 93.05
2g0c_A76 ATP-dependent RNA helicase DBPA; RNA recognition m 90.92
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 83.02
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
Probab=99.89  E-value=7e-23  Score=129.20  Aligned_cols=73  Identities=26%  Similarity=0.302  Sum_probs=70.0

Q ss_pred             eEeeeecCCcchhhHHHHHhccCCceeEEEEeccC----CceEEEEEeCCchHHHHHHhhcCCceecCeeeEEEecC
Q psy11609          2 ALFIYVVSDTSLKDGLYHEYKKHGKVSWVKIIGQG----GDRYGLVCFKKADDAEKAILGSHEKHFFGCKIDVSPYH   74 (83)
Q Consensus         2 ~lfv~k~~d~~~~d~L~~eF~kfG~Itsv~V~~d~----~~g~afV~F~~pEdA~~A~~~~ng~~~~g~~i~V~~a~   74 (83)
                      +|||++|+.+..+++|++.|++||+|.+|+|+.|.    ++|||||+|.++++|++|++.|||..|.|++|.|+.|+
T Consensus        21 ~lfV~nLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kG~afV~f~~~~~A~~Ai~~lng~~~~gr~l~V~~Ak   97 (99)
T 4fxv_A           21 NLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYAR   97 (99)
T ss_dssp             EEEEESCCTTCCHHHHHHHHHTTSCEEEEEEEECSSSCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECC
T ss_pred             EEEEeCCCCCCCHHHHHHHHHhcCCEEEeEeeecCCCCcccccEEEEECCHHHHHHHHHHhCCCEECCEEEEEEEee
Confidence            79999999999999999999999999999999875    48999999999999999999999999999999999985



>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2g0c_A ATP-dependent RNA helicase DBPA; RNA recognition motif, hydrolase; 1.70A {Bacillus subtilis} PDB: 3moj_B Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 83
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 3e-06
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 5e-06
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-05
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-04
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-04
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-04
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 4e-04
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 5e-04
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 5e-04
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 5e-04
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 6e-04
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 8e-04
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 0.001
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 0.001
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 0.002
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 0.002
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 0.003
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 0.004
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.004
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Calcipressin-1
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 39.4 bits (91), Expect = 3e-06
 Identities = 10/68 (14%), Positives = 23/68 (33%), Gaps = 2/68 (2%)

Query: 7  VVSDTSLKDGLYHEYKKHGKVSWVKIIGQGGDRYGLVCFKKADDAEKAILGSHEKHFFGC 66
          V S++  +      ++ + K +  +           + F     A  A L  H+  F G 
Sbjct: 17 VFSESETRAKFESLFRTYDKDTTFQYFKSFK--RVRINFSNPLSAADARLRLHKTEFLGK 74

Query: 67 KIDVSPYH 74
          ++ +    
Sbjct: 75 EMKLYFAQ 82


>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query83
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.89
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.88
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.88
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.88
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.88
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.88
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.87
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.87
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.87
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.87
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.87
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.86
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.86
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.86
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.86
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.86
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.86
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.86
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.86
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.86
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.85
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.85
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.85
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.85
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.85
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.85
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.85
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.85
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.85
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.85
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.84
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.84
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.84
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.84
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.84
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.83
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.83
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.83
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.83
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.83
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.83
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.83
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.83
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.83
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.83
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.83
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.83
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.82
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.82
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.81
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.81
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.81
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.81
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.81
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.81
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.81
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.8
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.8
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.8
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.8
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.8
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.79
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.79
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.78
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.78
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.78
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.77
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.77
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.76
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.76
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.76
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.76
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.76
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.73
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.73
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.72
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.72
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.72
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.71
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.69
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.69
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.68
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.67
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.66
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.64
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.54
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 98.45
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.89
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 93.58
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 91.06
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Poly(A)-binding protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89  E-value=1.9e-23  Score=126.17  Aligned_cols=74  Identities=16%  Similarity=0.227  Sum_probs=70.7

Q ss_pred             eEeeeecCCcchhhHHHHHhccCCceeEEEEeccC----CceEEEEEeCCchHHHHHHhhcCCceecCeeeEEEecCC
Q psy11609          2 ALFIYVVSDTSLKDGLYHEYKKHGKVSWVKIIGQG----GDRYGLVCFKKADDAEKAILGSHEKHFFGCKIDVSPYHD   75 (83)
Q Consensus         2 ~lfv~k~~d~~~~d~L~~eF~kfG~Itsv~V~~d~----~~g~afV~F~~pEdA~~A~~~~ng~~~~g~~i~V~~a~g   75 (83)
                      +|||++|+.+..+++|++.|++||+|.+|+|+.|.    ++|||||+|.++++|++|++.|||..+.|++|.|..|++
T Consensus         2 slfV~nL~~~~te~~l~~~F~~~G~i~~v~i~~d~~tg~~~g~aFV~f~~~~~a~~ai~~l~g~~~~gr~i~v~~a~~   79 (80)
T d1cvja1           2 SLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQR   79 (80)
T ss_dssp             EEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHTTSTTCEETTEECEEEECCC
T ss_pred             EEEEeCCCCcCCHHHHHHHHHHhCCEeEEEEEecccccCCCCceEEEECCHHHHHHHHHHcCCCEECCEEEEEEEeCC
Confidence            79999999999999999999999999999999976    479999999999999999999999999999999999874



>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure