Diaphorina citri psyllid: psy11611


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60
MSFLREELKYDDGAEKRQKAFHKNDDMHVSVKELWDVWIKSECCREDAGGQQHGGITSQG
ccHHHHHHcccccHHHHHHHHccccccEEEHHHHHHHHHHHHHccccccccccccccccc
**FLR*****************KNDDMHVSVKELWDVWIKSECCR***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFLREELKYDDGAEKRQKAFHKNDDMHVSVKELWDVWIKSECCREDAGGQQHGGITSQG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Stromal interaction molecule homolog Plays a role in mediating Ca(2+) influx following depletion of intracellular Ca(2+) stores.confidentP83094

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032237 [BP]activation of store-operated calcium channel activityprobableGO:0032414, GO:0032411, GO:0032412, GO:0051049, GO:1901341, GO:0034765, GO:0050789, GO:0034762, GO:0032409, GO:1901021, GO:0043269, GO:0044093, GO:0048518, GO:0065007, GO:0065009, GO:0051050, GO:0050794, GO:0010959, GO:0008150, GO:0032879, GO:1901019, GO:1901339, GO:0022898, GO:0051924, GO:2001259, GO:2001257
GO:0048763 [MF]calcium-induced calcium release activityprobableGO:0005261, GO:0005262, GO:0003674, GO:0015085, GO:0015278, GO:0015276, GO:0072509, GO:0022803, GO:0046873, GO:0008324, GO:0005218, GO:0005215, GO:0005216, GO:0005217, GO:0022891, GO:0022890, GO:0022892, GO:0015075, GO:0022857, GO:0015267, GO:0022836, GO:0022834, GO:0022839, GO:0022838
GO:0002115 [BP]store-operated calcium entryprobableGO:0072511, GO:0006812, GO:0006811, GO:0006810, GO:0006816, GO:0008150, GO:0044765, GO:0030001, GO:0070838, GO:0051234, GO:0051179, GO:0044699
GO:0051533 [BP]positive regulation of NFAT protein import into nucleusprobableGO:0033157, GO:0032388, GO:0060341, GO:0051049, GO:0032386, GO:0051222, GO:0051223, GO:0050789, GO:0032880, GO:0065007, GO:0048518, GO:0070201, GO:0051050, GO:0090316, GO:0050794, GO:0008150, GO:0042307, GO:0042306, GO:0032879, GO:0042993, GO:0042990, GO:1900180, GO:0051532, GO:0046824, GO:0046822
GO:0015279 [MF]store-operated calcium channel activityprobableGO:0022891, GO:0015085, GO:0022892, GO:0005261, GO:0005262, GO:0005215, GO:0005216, GO:0008324, GO:0015276, GO:0072509, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022834, GO:0022890, GO:0022803, GO:0022839, GO:0022838, GO:0046873
GO:0007476 [BP]imaginal disc-derived wing morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0022416 [BP]chaeta developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2K60, chain A
Confidence level:very confident
Coverage over the Query: 2-53
View the alignment between query and template
View the model in PyMOL