Diaphorina citri psyllid: psy11615


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MSVYFMAEKQLQQAREACEKLRKKRSSLVGAFVSTHGKSIDDVDRNSTSHVKDYILGTLILIALTICWYVYRQKESSQQHLRRMMKDMEGLQRAELDLANLQKELERARQEQENAASEKIKLERRLQEHQALQGDASDLKSSSAFSDLEVCQLKQEIELLRNELQRAEGELEDRCWAPPPGLQHWLQLTHEIENKAYVKKKLMAEKQLQQAREARFDRGKCIYT
ccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
************************RSSLVGAFVSTHGKSIDDV*RNSTSHVKDYILGTLILIALTICWYVYRQKE************************************************************************LEVCQLKQEIELLRNELQRAEGELEDRCWAPPPGLQHWLQLTHEIENKAYVKKKLMA*************RG*CI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVxxxxxxxxxxxxxxxxxxxxxxxxxxxxFVSTHGKSIDDVDRNSTSHVKDYILGTLILIALTICWYVYRQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQGDASDLKSSSAFSDLExxxxxxxxxxxxxxxxxxxxxxxxxCWAPPPGLQHWLQLTHEIExxxxxxxxxxxxxxxxxxxxxRFDRGKCIYT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Stromal interaction molecule homolog Plays a role in mediating Ca(2+) influx following depletion of intracellular Ca(2+) stores.confidentP83094

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003674 [MF]molecular_functionprobable
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TEQ, chain A
Confidence level:very confident
Coverage over the Query: 5-60
View the alignment between query and template
View the model in PyMOL
Template: 3TEQ, chain A
Confidence level:very confident
Coverage over the Query: 179-221
View the alignment between query and template
View the model in PyMOL
Template: 3TER, chain A
Confidence level:very confident
Coverage over the Query: 155-221
View the alignment between query and template
View the model in PyMOL
Template: 2I1J, chain A
Confidence level:probable
Coverage over the Query: 117-178
View the alignment between query and template
View the model in PyMOL
Template: 3O0Z, chain A
Confidence level:probable
Coverage over the Query: 77-168
View the alignment between query and template
View the model in PyMOL