Diaphorina citri psyllid: psy11626

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590------
MTFKRKDLSKDTRMEDHLSKDQYHIHSNLYFISSGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSLDKELDTDKNKGKELFKQITALKTFQPNLNIMLSVGGFEDDDDKEKYLEVLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFLYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLEESSHKSGIPPLVADGAGEKGTITKEEGLLSYAEICPQLVSITNAQASPSLLRKQEDPQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRGMCNSNKFPILRAARTQFV
cccccccccccccccccccccEEEEECcCEEEccccccccccccccccccccEEEEEEEEECccccEEEEEccccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHccHHHHHHHHHHHHHHHHHcccccCEECcccccccccccccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEECccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccCCcccccccccccccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHcccccccEEEEcccccCEEEEccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccCECccccccccccccccccccccccccCEEECccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccHHHHHHHHHc
********************DQYHIHSNLYFISSGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSLDKELDTDKNKGKELFKQITALKTFQPNLNIMLSVGGFEDDDDKEKYLEVLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFLYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLEESSHKSGIPPLVADGAGEKGTITKEEGLLSYAEICPQLVSITNAQASPSLLRKQEDPQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRGMCNSNKFPILRAARTQFV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTFKRKDLSKDTRMEDHLSKDQYHIHSNLYFISSGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSLDKELDTDKNKGKELFKQITALKTFQPNLNIMLSVGGFEDDDDKEKYLEVLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFLYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLEESSHKSGIPPLVADGAGEKGTITKEEGLLSYAEICPQLVSITNAQASPSLLRKQEDPQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRGMCNSNKFPILRAARTQFV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005576 [CC]extracellular regionprobableGO:0005575
GO:0007444 [BP]imaginal disc developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0008084 [MF]imaginal disc growth factor receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515, GO:0070851

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QOK, chain A
Confidence level:very confident
Coverage over the Query: 21-170,182-206,368-595
View the alignment between query and template
View the model in PyMOL
Template: 1GOI, chain A
Confidence level:very confident
Coverage over the Query: 19-156,186-216,378-595
View the alignment between query and template
View the model in PyMOL
Template: 1JND, chain A
Confidence level:very confident
Coverage over the Query: 20-161,181,341-595
View the alignment between query and template
View the model in PyMOL
Template: 1JND, chain A
Confidence level:very confident
Coverage over the Query: 186-242,265-333
View the alignment between query and template
View the model in PyMOL