Psyllid ID: psy11626

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590------
MTFKRKDLSKDTRMEDHLSKDQYHIHSNLYFISSGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSLDKELDTDKNKGKELFKQITALKTFQPNLNIMLSVGGFEDDDDKEKYLEVLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFLYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLEESSHKSGIPPLVADGAGEKGTITKEEGLLSYAEICPQLVSITNAQASPSLLRKQEDPQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRGMCNSNKFPILRAARTQFV
cccccccccccccccccccccEEEEEEcEEEEccccccccccccccccccccEEEEEEEEEEccccEEEEEccccccccccccHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHccHHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEcccccccccccccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHcccccccEEEEcccccEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccEEEccccccccccccccccccccccccEEEEEccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccHHHHHHHHHc
ccccccccccccccccccccEEEEEEccccEEccccccccccccccHHHcccEEEEEEEEEccccEEEEEEcccccccccccccHHHHHHHHHHHHccccEEEEEEcccccccccccHHHHHccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEccccEEEcccccccccHHHHHHHHHHHHHHHHHHcccccEEcccccccccEEEEEEcHHHcccccEEEEEEcccccccccccccccccccccccccEEEEEEcccccccccHHHcccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEHcccEEEEccccccccHHHHHHHHHHHHHHHHHHcHcccEEEEEEcccccHcccccHHHHHHHHcHHHHHEEcccccccccccccccccccccccccccccHHHHHHHHHHccccHHHEEEEccccccEEEEEccccccccccccccccccccccccHccHHHHHHHHHHHHccccEEEcccccccccccccccccEEEcccccccccccccEEccccHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccHHHHHHHHHcc
mtfkrkdlskdtrmedhlskdqyhihsnlyfissgtakvgpeelkpalsmCTHLVYgfagisdsgdyhIKSLDKELDTDKNKGKELFKQITALKTfqpnlnimlsvggfeddddkekylevlddpkyrKSFIETTVAALKKYGfngldlawefpvvtekhesytlgSIWHKIKktvtgpkddnptlhrEHFTLLIREMKAAFRAENFLLsasvlphvnytvyfdvpsitqhlDMITLHAYDflyfdvpsitqhlDMITLhaydfrtpqrnpkeadysaplhflddpkyrKSFIETTVAALKKYGfngldlawefpvvtekhesytlgSIWHKIKktvtgpkddnptlhrEHFTLLIREMKAAFRAENFLLsasvlphvnytvyfdvpsitqhlDMITLhaydfrtpqrnpkeadysaplhfvygrvphqNANAMVRWFIEHGVELQKLVlgiptfgrswlleesshksgipplvadgagekgtitkEEGLLSYAEICPQLVSItnaqaspsllrkqedpqrrlGTYAFRLADKKLKqeygtwvsfeepetagykaSYAKLAGLGGVAIIDLSLddfrgmcnsnkfPILRAARTQFV
mtfkrkdlskdtrmedhlskdqyhIHSNLYFISSGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSLDKELDTDKNKGKELFKQITalktfqpnlNIMLSVGGFEDDDDKEKYLevlddpkyrkSFIETTVAALKKYGFNGLDLAWEFPVVTEKHEsytlgsiwhKIKKtvtgpkddnptlHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFLYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHEsytlgsiwhKIKKtvtgpkddnptlHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLEEsshksgipplvadgagEKGTITKEEGLLSYAEICPQLVSITnaqaspsllrkqedpqrrLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRGMCNSNKFPILRAARTQFV
MTFKRKDLSKDTRMEDHLSKDQYHIHSNLYFISSGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSLDKELDTDKNKGKELFKQITALKTFQPNLNIMLSVGGFEDDDDKEKYLEVLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFLYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLEESSHKSGIPPLVADGAGEKGTITKEEGLLSYAEICPQLVSITNAQASPSLLRKQEDPQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRGMCNSNKFPILRAARTQFV
*********************QYHIHSNLYFISSGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSL************ELFKQITALKTFQPNLNIMLSV**************VLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFLYFDVPSITQHLDMITLHAYDFRT*********YSAPLHFLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTP******ADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLE********************TITKEEGLLSYAEICPQLVSITN*****************LGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRGMCNSNKFPILR*******
********************DQYHIHSNLYFISSGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSLDKELDTDKNKGKELFKQITALKTFQPNLNIMLSVGGFEDDDDKEKYLEVLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVT******PTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFLYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVT*****NPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLEESSHKSGIPPLVADGAGEKGTITKEEGLLSYAEICPQLVSITNAQASPSLLRKQEDPQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRGMCNSNKFPILRAARTQFV
**************EDHLSKDQYHIHSNLYFISSGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSLDKELDTDKNKGKELFKQITALKTFQPNLNIMLSVGGFEDDDDKEKYLEVLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFLYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLEESSHKSGIPPLVADGAGEKGTITKEEGLLSYAEICPQLVSITNAQASPSLLRKQEDPQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRGMCNSNKFPILRAARTQFV
*****************LSKDQYHIHSNLYFISSGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSLDKELDTDKNKGKELFKQITALKTFQPNLNIMLSVGGFEDDDDKEKYLEVLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFLYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLEESSHKSGIPPLVADGAGEKGTITKEEGLLSYAEICPQLVSITNAQASPSLLRKQEDPQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRGMCNSNKFPILRAARTQFV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTFKRKDLSKDTRMEDHLSKDQYHIHSNLYFISSGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSLDKELDTDKNKGKELFKQITALKTFQPNLNIMLSVGGFEDDDDKEKYLEVLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFLYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLEESSHKSGIPPLVADGAGEKGTITKEEGLLSYAEICPQLVSITNAQASPSLLRKQEDPQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRGMCNSNKFPILRAARTQFV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query596 2.2.26 [Sep-21-2011]
Q9GV28433 Chitinase-like protein EN N/A N/A 0.515 0.709 0.480 2e-76
Q2PQM7444 Chitinase-like protein Id N/A N/A 0.538 0.722 0.426 2e-75
Q23997452 Chitinase-like protein CG yes N/A 0.520 0.685 0.423 4e-72
Q9W303442 Chitinase-like protein Id no N/A 0.526 0.710 0.422 1e-70
Q9V3D4440 Chitinase-like protein Id no N/A 0.521 0.706 0.419 9e-67
Q8MX41439 Chitinase-like protein Id N/A N/A 0.506 0.687 0.432 2e-64
Q8MX40439 Chitinase-like protein Id N/A N/A 0.506 0.687 0.426 3e-64
Q8MM24439 Chitinase-like protein Id no N/A 0.501 0.681 0.428 5e-64
Q8MLZ7441 Chitinase-like protein Id no N/A 0.510 0.689 0.403 4e-62
Q8MX32441 Chitinase-like protein Id N/A N/A 0.510 0.689 0.396 2e-61
>sp|Q9GV28|IDGFL_BOMMO Chitinase-like protein EN03 OS=Bombyx mori GN=EN03 PE=1 SV=1 Back     alignment and function desciption
 Score =  287 bits (734), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 151/314 (48%), Positives = 200/314 (63%), Gaps = 7/314 (2%)

Query: 282 FLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTV-TGP 340
            L+  + R +FI + V   ++YGF+G+DLAW+FP V  K    T GS+WH IKKT  T P
Sbjct: 121 LLESQQARTAFINSGVLLAEQYGFDGIDLAWQFPRVKPKKIRSTWGSLWHGIKKTFGTTP 180

Query: 341 KDDNPTLHREHFTLLIREMKAAF-RAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLH 399
            D+  + HRE FT L+RE+K A        L  +VLP+VN T+Y DVP+I   +D + + 
Sbjct: 181 VDEKESEHREGFTALVRELKQALIHKPKMQLGVTVLPNVNSTIYHDVPAIINLVDYVNVG 240

Query: 400 AYDFRTPQRNPKEADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSW 459
           AYD+ TP RN KEADY+AP++    R P QNA+A V +++  G   QK+VL      RS+
Sbjct: 241 AYDYYTPTRNNKEADYTAPIYTPQNRNPLQNADAAVTYWLTSGAPSQKIVLSXRL--RSY 298

Query: 460 L-LEESSHKSGIPPLVADGAGEKGTITKEEGLLSYAEICPQLVSITNAQASPSLLRKQED 518
           L     S  +G+PP+  DG GE G   K EGLLSY E+C +L++    +     LRK  D
Sbjct: 299 LETGXDSEIAGVPPIHTDGPGEAGPYVKTEGLLSYPEVCGKLINPNQQKGMRPHLRKVTD 358

Query: 519 PQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRG 578
           P +R GTYAFRL D     E G WVS+E+P+TAG KA+Y K   LGGVAI+DLSLDDFRG
Sbjct: 359 PSKRFGTYAFRLPDDN--GEGGIWVSYEDPDTAGQKAAYVKSKNLGGVAIVDLSLDDFRG 416

Query: 579 MCNSNKFPILRAAR 592
           +C  +K+PILRAA+
Sbjct: 417 LCTGDKYPILRAAK 430

Bombyx mori (taxid: 7091)
>sp|Q2PQM7|IDGF4_GLOMM Chitinase-like protein Idgf4 OS=Glossina morsitans morsitans GN=Idgf4 PE=2 SV=1 Back     alignment and function description
>sp|Q23997|C5210_DROME Chitinase-like protein CG5210 OS=Drosophila melanogaster GN=CG5210 PE=1 SV=2 Back     alignment and function description
>sp|Q9W303|IDGF4_DROME Chitinase-like protein Idgf4 OS=Drosophila melanogaster GN=Idgf4 PE=2 SV=1 Back     alignment and function description
>sp|Q9V3D4|IDGF2_DROME Chitinase-like protein Idgf2 OS=Drosophila melanogaster GN=Idgf2 PE=1 SV=1 Back     alignment and function description
>sp|Q8MX41|IDGF1_DROSI Chitinase-like protein Idgf1 OS=Drosophila simulans GN=Idgf1 PE=3 SV=1 Back     alignment and function description
>sp|Q8MX40|IDGF1_DROYA Chitinase-like protein Idgf1 OS=Drosophila yakuba GN=Idgf1 PE=3 SV=1 Back     alignment and function description
>sp|Q8MM24|IDGF1_DROME Chitinase-like protein Idgf1 OS=Drosophila melanogaster GN=Idgf1 PE=1 SV=2 Back     alignment and function description
>sp|Q8MLZ7|IDGF3_DROME Chitinase-like protein Idgf3 OS=Drosophila melanogaster GN=Idgf3 PE=1 SV=3 Back     alignment and function description
>sp|Q8MX32|IDGF3_DROSI Chitinase-like protein Idgf3 OS=Drosophila simulans GN=Idgf3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query596
389610773434 imaginal disc growth factor 4 [Papilio p 0.518 0.711 0.498 4e-86
389608675393 imaginal disc growth factor 4 [Papilio x 0.518 0.786 0.492 1e-85
85726208433 imaginal disc growth factor-like protein 0.520 0.715 0.496 8e-85
274327724442 imaginal disk growth factor precursor [A 0.520 0.701 0.525 1e-84
53830694431 putative imaginal disc growth factor [On 0.483 0.668 0.514 2e-84
259493819434 hemocyte aggregation inhibitor protein p 0.523 0.718 0.477 5e-83
152061158434 imaginal disk growth factor [Bombyx mori 0.518 0.711 0.495 2e-81
357625069434 hemocyte aggregation inhibitor protein p 0.518 0.711 0.479 4e-81
113206042439 imaginal disc growth factor 2 precursor 0.525 0.712 0.468 7e-81
113206046431 imaginal disc growth factor 4 precursor 0.513 0.709 0.482 3e-80
>gi|389610773|dbj|BAM18997.1| imaginal disc growth factor 4 [Papilio polytes] Back     alignment and taxonomy information
 Score =  325 bits (834), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 156/313 (49%), Positives = 213/313 (68%), Gaps = 4/313 (1%)

Query: 282 FLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKT-VTGP 340
            L+ P+ R +F+ + V   +++GF G+DLAW+FP +  K    T GSIWH IKKT  T P
Sbjct: 121 LLESPQARTAFVNSAVLLAEQHGFEGIDLAWQFPKIKPKKIRSTWGSIWHGIKKTFATTP 180

Query: 341 KDDNPTLHREHFTLLIREMKAAFRAE-NFLLSASVLPHVNYTVYFDVPSITQHLDMITLH 399
            DD  T HRE FT L+REMK A   + N  LS ++LP+VN ++Y DVP+I  H+D + L 
Sbjct: 181 VDDKETEHREGFTALVREMKQALSLKPNMQLSVTILPNVNASIYIDVPAIINHVDFVNLE 240

Query: 400 AYDFRTPQRNPKEADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSW 459
           ++D+ TPQRNPKEADY+AP++    R    NANA V +F + G    K+V+GI TFGR+W
Sbjct: 241 SFDYTTPQRNPKEADYTAPIYTPQNRNELLNANAAVNYFTQAGAPAYKIVVGIATFGRTW 300

Query: 460 LLEESSHKSGIPPLVADGAGEKGTITKEEGLLSYAEICPQLVSITNAQASPSLLRKQEDP 519
            L+  S  +G+PP+ A+G GE G  TK EGLLSY E+C +L++  + +     LRK  DP
Sbjct: 301 ALDSDSEIAGVPPIHANGPGEAGPYTKTEGLLSYPEVCAKLINPNHQKGMRPHLRKVTDP 360

Query: 520 QRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRGM 579
            +R GTYAFR+ D     E G WVS+E+P+TA  KA++ K  GLGGV+I+DLS+DDFRG+
Sbjct: 361 SKRFGTYAFRVPDD--NGEGGFWVSYEDPDTAAQKAAFVKSRGLGGVSIVDLSMDDFRGL 418

Query: 580 CNSNKFPILRAAR 592
           C S+K+PILRAA+
Sbjct: 419 CTSDKYPILRAAK 431

Source: Papilio polytes

Species: Papilio polytes

Genus: Papilio

Family: Papilionidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|389608675|dbj|BAM17947.1| imaginal disc growth factor 4 [Papilio xuthus] Back     alignment and taxonomy information
>gi|85726208|gb|ABC79625.1| imaginal disc growth factor-like protein [Mamestra brassicae] Back     alignment and taxonomy information
>gi|274327724|ref|NP_001162142.1| imaginal disk growth factor precursor [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|53830694|gb|AAU95190.1| putative imaginal disc growth factor [Oncometopia nigricans] Back     alignment and taxonomy information
>gi|259493819|gb|ACW82749.1| hemocyte aggregation inhibitor protein precursor [Manduca sexta] Back     alignment and taxonomy information
>gi|152061158|dbj|BAF73623.1| imaginal disk growth factor [Bombyx mori] Back     alignment and taxonomy information
>gi|357625069|gb|EHJ75621.1| hemocyte aggregation inhibitor protein precursor [Danaus plexippus] Back     alignment and taxonomy information
>gi|113206042|ref|NP_001038092.1| imaginal disc growth factor 2 precursor [Tribolium castaneum] gi|109895318|gb|ABG47451.1| imaginal disc growth factor 2 [Tribolium castaneum] gi|270007357|gb|EFA03805.1| hypothetical protein TcasGA2_TC013918 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|113206046|ref|NP_001038091.1| imaginal disc growth factor 4 precursor [Tribolium castaneum] gi|109895320|gb|ABG47452.1| imaginal disc growth factor 4 [Tribolium castaneum] gi|270007356|gb|EFA03804.1| hypothetical protein TcasGA2_TC013917 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query596
UNIPROTKB|Q9GV28433 EN03 "Chitinase-like protein E 0.530 0.729 0.472 4.1e-72
FB|FBgn0013763452 CG5210 [Drosophila melanogaste 0.520 0.685 0.423 9.2e-68
FB|FBgn0026415442 Idgf4 "Imaginal disc growth fa 0.525 0.708 0.423 2.2e-66
FB|FBgn0020415440 Idgf2 "Imaginal disc growth fa 0.521 0.706 0.419 4.7e-64
UNIPROTKB|Q8MX41439 Idgf1 "Chitinase-like protein 0.662 0.899 0.374 6.2e-62
FB|FBgn0020416439 Idgf1 "Imaginal disc growth fa 0.657 0.892 0.372 4.3e-61
UNIPROTKB|Q8MX40439 Idgf1 "Chitinase-like protein 0.662 0.899 0.364 5.5e-61
FB|FBgn0020414441 Idgf3 "Imaginal disc growth fa 0.503 0.680 0.408 1.7e-59
UNIPROTKB|Q8MX32441 Idgf3 "Chitinase-like protein 0.503 0.680 0.401 1.2e-58
FB|FBgn0064237444 Idgf5 "Imaginal disc growth fa 0.530 0.711 0.390 1.9e-58
UNIPROTKB|Q9GV28 EN03 "Chitinase-like protein EN03" [Bombyx mori (taxid:7091)] Back     alignment and assigned GO terms
 Score = 729 (261.7 bits), Expect = 4.1e-72, P = 4.1e-72
 Identities = 154/326 (47%), Positives = 205/326 (62%)

Query:   273 EADYSAPLHF---LDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSI 329
             +AD   P  +   L+  + R +FI + V   ++YGF+G+DLAW+FP V  K    T GS+
Sbjct:   109 DADTEEPEKYNLLLESQQARTAFINSGVLLAEQYGFDGIDLAWQFPRVKPKKIRSTWGSL 168

Query:   330 WHKIKKTV-TGPKDDNPTLHREHFTLLIREMKAAF-RAENFLLSASVLPHVNYTVYFDVP 387
             WH IKKT  T P D+  + HRE FT L+RE+K A        L  +VLP+VN T+Y DVP
Sbjct:   169 WHGIKKTFGTTPVDEKESEHREGFTALVRELKQALIHKPKMQLGVTVLPNVNSTIYHDVP 228

Query:   388 SITQHLDMITLHAYDFRTPQRNPKEADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQK 447
             +I   +D + + AYD+ TP RN KEADY+AP++    R P QNA+A V +++  G   QK
Sbjct:   229 AIINLVDYVNVGAYDYYTPTRNNKEADYTAPIYTPQNRNPLQNADAAVTYWLTSGAPSQK 288

Query:   448 LVLGIPTFGRSWL-LEESSHKSGIPPLVADGAGEKGTITKEEGLLSYAEICPQLVSITNA 506
             +VL      RS+L     S  +G+PP+  DG GE G   K EGLLSY E+C +L++    
Sbjct:   289 IVLSXRL--RSYLETGXDSEIAGVPPIHTDGPGEAGPYVKTEGLLSYPEVCGKLINPNQQ 346

Query:   507 QASPSLLRKQEDPQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGV 566
             +     LRK  DP +R GTYAFRL D     E G WVS+E+P+TAG KA+Y K   LGGV
Sbjct:   347 KGMRPHLRKVTDPSKRFGTYAFRLPDDN--GEGGIWVSYEDPDTAGQKAAYVKSKNLGGV 404

Query:   567 AIIDLSLDDFRGMCNSNKFPILRAAR 592
             AI+DLSLDDFRG+C  +K+PILRAA+
Sbjct:   405 AIVDLSLDDFRGLCTGDKYPILRAAK 430
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
FB|FBgn0013763 CG5210 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0026415 Idgf4 "Imaginal disc growth factor 4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0020415 Idgf2 "Imaginal disc growth factor 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MX41 Idgf1 "Chitinase-like protein Idgf1" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
FB|FBgn0020416 Idgf1 "Imaginal disc growth factor 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MX40 Idgf1 "Chitinase-like protein Idgf1" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
FB|FBgn0020414 Idgf3 "Imaginal disc growth factor 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MX32 Idgf3 "Chitinase-like protein Idgf3" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
FB|FBgn0064237 Idgf5 "Imaginal disc growth factor 5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query596
cd02873413 cd02873, GH18_IDGF, The IDGF's (imaginal disc grow 1e-145
cd02873413 cd02873, GH18_IDGF, The IDGF's (imaginal disc grow 3e-89
cd02872362 cd02872, GH18_chitolectin_chitotriosidase, This co 1e-55
smart00636334 smart00636, Glyco_18, Glyco_18 domain 3e-52
cd02872362 cd02872, GH18_chitolectin_chitotriosidase, This co 1e-41
smart00636334 smart00636, Glyco_18, Glyco_18 domain 4e-40
pfam00704325 pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam 5e-39
pfam00704325 pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam 5e-32
cd00598210 cd00598, GH18_chitinase-like, The GH18 (glycosyl h 1e-28
cd02879299 cd02879, GH18_plant_chitinase_class_V, The class V 7e-24
cd06548322 cd06548, GH18_chitinase, The GH18 (glycosyl hydrol 2e-23
cd06548322 cd06548, GH18_chitinase, The GH18 (glycosyl hydrol 1e-19
cd00598210 cd00598, GH18_chitinase-like, The GH18 (glycosyl h 5e-18
cd02879299 cd02879, GH18_plant_chitinase_class_V, The class V 9e-17
COG3325441 COG3325, ChiA, Chitinase [Carbohydrate transport a 2e-12
COG3325441 COG3325, ChiA, Chitinase [Carbohydrate transport a 3e-11
cd02874313 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm 4e-11
cd02875358 cd02875, GH18_chitobiase, Chitobiase (also known a 9e-08
cd02874313 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm 1e-05
cd06545253 cd06545, GH18_3CO4_chitinase, The Bacteroides thet 3e-05
cd06545253 cd06545, GH18_3CO4_chitinase, The Bacteroides thet 7e-04
COG3858423 COG3858, COG3858, Predicted glycosyl hydrolase [Ge 0.002
cd06548322 cd06548, GH18_chitinase, The GH18 (glycosyl hydrol 0.003
cd02878345 cd02878, GH18_zymocin_alpha, Zymocin, alpha subuni 0.003
>gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information 
 Score =  424 bits (1093), Expect = e-145
 Identities = 154/313 (49%), Positives = 207/313 (66%), Gaps = 5/313 (1%)

Query: 283 LDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTGP-- 340
           L+  + R +FI +  + LK YGF+GLDLAW+FP    K    T GS WH  KK  TG   
Sbjct: 100 LESSESRNAFINSAHSLLKTYGFDGLDLAWQFPKNKPKKVRGTFGSAWHSFKKLFTGDSV 159

Query: 341 KDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHA 400
            D+    H+E FT L+RE+K A R +  LL+ +VLPHVN T YFDVP+I  ++D + L  
Sbjct: 160 VDEKAAEHKEQFTALVRELKNALRPDGLLLTLTVLPHVNSTWYFDVPAIANNVDFVNLAT 219

Query: 401 YDFRTPQRNPKEADYSAPLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWL 460
           +DF TP+RNP+EADY+AP++ +Y R PH N +  V++++  G    KL LGI T+GR+W 
Sbjct: 220 FDFLTPERNPEEADYTAPIYELYERNPHHNVDYQVKYWLNQGTPASKLNLGIATYGRAWK 279

Query: 461 LEESSHKSGIPP-LVADGAGEKGTITKEEGLLSYAEICPQLVSITNAQASPSLLRKQEDP 519
           L + S  +G+PP L  DG G  G  TK  GLLS+ EIC +L +  N + + + LRK  DP
Sbjct: 280 LTKDSGITGVPPVLETDGPGPAGPQTKTPGLLSWPEICSKLPNPANLKGADAPLRKVGDP 339

Query: 520 QRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRGM 579
            +R G+YA+R AD+    E+G WVS+E+P+TA  KA YAK  GLGGVA+ DLSLDDFRG 
Sbjct: 340 TKRFGSYAYRPADE--NGEHGIWVSYEDPDTAANKAGYAKAKGLGGVALFDLSLDDFRGQ 397

Query: 580 CNSNKFPILRAAR 592
           C  +KFPILR+A+
Sbjct: 398 CTGDKFPILRSAK 410

The IDGF's have an eight-stranded alpha/beta barrel fold and are related to the glycosyl hydrolase family 18 (GH18) chitinases, but they have an amino acid substitution known to abolish chitinase catalytic activity. IDGFs may have evolved from chitinases to gain new functions as growth factors, interacting with cell surface glycoproteins involved in growth-promoting processes. Length = 413
>gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain Back     alignment and domain information
>gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain Back     alignment and domain information
>gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 Back     alignment and domain information
>gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 Back     alignment and domain information
>gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods Back     alignment and domain information
>gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
>gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods Back     alignment and domain information
>gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
>gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>gnl|CDD|119354 cd02875, GH18_chitobiase, Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>gnl|CDD|119362 cd06545, GH18_3CO4_chitinase, The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>gnl|CDD|119362 cd06545, GH18_3CO4_chitinase, The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>gnl|CDD|226376 COG3858, COG3858, Predicted glycosyl hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>gnl|CDD|119357 cd02878, GH18_zymocin_alpha, Zymocin, alpha subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 596
cd02873413 GH18_IDGF The IDGF's (imaginal disc growth factors 100.0
cd02872362 GH18_chitolectin_chitotriosidase This conserved do 100.0
KOG2806|consensus432 100.0
COG3325441 ChiA Chitinase [Carbohydrate transport and metabol 100.0
cd02878345 GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin 100.0
smart00636334 Glyco_18 Glycosyl hydrolase family 18. 100.0
cd02879299 GH18_plant_chitinase_class_V The class V plant chi 100.0
cd06548322 GH18_chitinase The GH18 (glycosyl hydrolases, fami 100.0
PF00704343 Glyco_hydro_18: Glycosyl hydrolases family 18; Int 100.0
cd02876318 GH18_SI-CLP Stabilin-1 interacting chitinase-like 100.0
cd02875358 GH18_chitobiase Chitobiase (also known as di-N-ace 100.0
cd02874313 GH18_CFLE_spore_hydrolase Cortical fragment-lytic 100.0
cd06545253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 100.0
cd06549298 GH18_trifunctional GH18 domain of an uncharacteriz 100.0
cd00598210 GH18_chitinase-like The GH18 (glycosyl hydrolase, 100.0
cd06544253 GH18_narbonin Narbonin is a plant 2S protein from 99.97
cd06546256 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 99.97
COG3858423 Predicted glycosyl hydrolase [General function pre 99.97
cd02871312 GH18_chitinase_D-like GH18 domain of Chitinase D ( 99.96
cd06542255 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases 99.83
cd06543294 GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch 99.8
cd02877280 GH18_hevamine_XipI_class_III This conserved domain 99.8
KOG2091|consensus392 99.8
cd06542255 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases 99.63
cd02873413 GH18_IDGF The IDGF's (imaginal disc growth factors 99.4
COG3469332 Chitinase [Carbohydrate transport and metabolism] 99.4
cd06543294 GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch 99.29
cd06548322 GH18_chitinase The GH18 (glycosyl hydrolases, fami 99.16
cd02876318 GH18_SI-CLP Stabilin-1 interacting chitinase-like 99.09
cd02872362 GH18_chitolectin_chitotriosidase This conserved do 99.07
cd02878345 GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin 99.05
COG3325441 ChiA Chitinase [Carbohydrate transport and metabol 99.0
cd02875358 GH18_chitobiase Chitobiase (also known as di-N-ace 98.98
cd06549298 GH18_trifunctional GH18 domain of an uncharacteriz 98.88
cd06545253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 98.84
cd02879299 GH18_plant_chitinase_class_V The class V plant chi 98.83
cd06544253 GH18_narbonin Narbonin is a plant 2S protein from 98.79
PF00704343 Glyco_hydro_18: Glycosyl hydrolases family 18; Int 98.72
cd02874313 GH18_CFLE_spore_hydrolase Cortical fragment-lytic 98.72
smart00636334 Glyco_18 Glycosyl hydrolase family 18. 98.66
cd06546256 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 98.54
KOG2806|consensus432 98.53
cd02871312 GH18_chitinase_D-like GH18 domain of Chitinase D ( 98.46
cd00598210 GH18_chitinase-like The GH18 (glycosyl hydrolase, 98.19
cd06547339 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG 97.95
COG3469332 Chitinase [Carbohydrate transport and metabolism] 97.87
COG3858423 Predicted glycosyl hydrolase [General function pre 97.85
KOG4701|consensus568 97.76
cd02877280 GH18_hevamine_XipI_class_III This conserved domain 97.46
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 97.13
PF03644311 Glyco_hydro_85: Glycosyl hydrolase family 85 ; Int 97.13
PF11340181 DUF3142: Protein of unknown function (DUF3142); In 96.95
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 96.83
cd06547339 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG 96.64
PF11340181 DUF3142: Protein of unknown function (DUF3142); In 96.21
TIGR01370315 cysRS possible cysteinyl-tRNA synthetase, Methanoc 96.21
PF13200316 DUF4015: Putative glycosyl hydrolase domain 95.78
PF03644311 Glyco_hydro_85: Glycosyl hydrolase family 85 ; Int 95.41
KOG2091|consensus392 95.33
PF13200316 DUF4015: Putative glycosyl hydrolase domain 94.94
PF14883294 GHL13: Hypothetical glycosyl hydrolase family 13 92.62
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 89.38
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 88.69
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 87.5
PF02065394 Melibiase: Melibiase; InterPro: IPR000111 O-Glycos 86.38
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 83.56
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 83.55
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 82.59
TIGR00542279 hxl6Piso_put hexulose-6-phosphate isomerase, putat 82.49
PF13199559 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 82.18
PRK13209283 L-xylulose 5-phosphate 3-epimerase; Reviewed 82.11
TIGR03234254 OH-pyruv-isom hydroxypyruvate isomerase. This enzy 81.39
cd06595292 GH31_xylosidase_XylS-like This family represents a 80.69
KOG4701|consensus 568 80.02
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information 
Probab=100.00  E-value=1.1e-77  Score=646.32  Aligned_cols=409  Identities=48%  Similarity=0.871  Sum_probs=333.1

Q ss_pred             CceeEeeeeeeecCCCCCCCCCCcCCCCCcccEEEEEEEEecCCCceEEecCCccccccccchhhhHHHHHHHhhhCCCc
Q psy11626         21 DQYHIHSNLYFISSGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSLDKELDTDKNKGKELFKQITALKTFQPNL  100 (596)
Q Consensus        21 ~~~~~~~~~~~~~~g~~~~~~~~i~~~~~~~Thviyafa~v~~~g~~~~~~~~~~~d~~~~~~~~~~~~~~~lk~~~p~l  100 (596)
                      .++|||++|++||.+.++|.|++||+.+++||||+|||+.|+++ ++.+...+++.+..    ...++++.+||++||++
T Consensus         1 ~vvcyy~~~a~~r~~~~~~~~~~i~~~~~~~THl~yaf~~i~~~-~~~~~~~~~~~~~~----~~~~~~~~~lk~~~p~l   75 (413)
T cd02873           1 KLVCYYDSKSYLREGLAKMSLEDLEPALQFCTHLVYGYAGIDAD-TYKIKSLNEDLDLD----KSHYRAITSLKRKYPHL   75 (413)
T ss_pred             CEEEEecchhhcCCCCCeeCHHHcCCccccCCeEEEEEEEEeCC-CCEEEecCcccchh----hhHHHHHHHHHhhCCCC
Confidence            36899999999999999999999998777899999999999943 56777767666654    57899999999999999


Q ss_pred             eEEEEEcCCCCCCC---hhhhhhhcCCHHHHHHHHHHHHHHHHHhCCCeeeeeccCCCcCccccccccccchhccccccc
Q psy11626        101 NIMLSVGGFEDDDD---KEKYLEVLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVT  177 (596)
Q Consensus       101 kvllsiGG~~~~~~---s~~f~~~~~~~~~r~~f~~si~~~l~~~gfDGvdiDwE~p~~~~~~~~~~~~~~~~~~~~~~~  177 (596)
                      |||||||||+....   +..|+.++++++.|++||++|++||++|+|||||||||||...+....+++|+.|+.||+.+.
T Consensus        76 KvllSiGGw~~~~~~~~s~~fs~~~~~~~~R~~Fi~siv~~l~~~~fDGidiDWEyP~~~~~~~~g~~~~~~~~~~~~~~  155 (413)
T cd02873          76 KVLLSVGGDRDTDEEGENEKYLLLLESSESRNAFINSAHSLLKTYGFDGLDLAWQFPKNKPKKVRGTFGSAWHSFKKLFT  155 (413)
T ss_pred             eEEEeecCCCCCCCcccchhhHHHhCCHHHHHHHHHHHHHHHHHcCCCCeEeeeeCCCCcccccccccchhhhhhhcccc
Confidence            99999999986321   467999999999999999999999999999999999999987654444567777877766554


Q ss_pred             CCCCCCCccchHHHHHHHHHHHHHhhhcCcEEEEEecCCcccccccchhhhhcccceeeeeccccccCCccccccccccc
Q psy11626        178 GPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFLYFDVPSITQHLDMI  257 (596)
Q Consensus       178 g~~~~~~~~d~~~~~~ll~~Lr~~l~~~~~~ls~av~~~~~~~~~~~~~~~~~~~d~i~~m~Yd~~~~~~~~~~~~~d~~  257 (596)
                      |+..                                                                            
T Consensus       156 g~~~----------------------------------------------------------------------------  159 (413)
T cd02873         156 GDSV----------------------------------------------------------------------------  159 (413)
T ss_pred             cccc----------------------------------------------------------------------------
Confidence            4310                                                                            


Q ss_pred             ccccccCCCCCCCCCCCCCCCCcccCCChHHHHHHHHHHHHHHHHhCCCccceeeecCcccCCccccccccceecccccc
Q psy11626        258 TLHAYDFRTPQRNPKEADYSAPLHFLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTV  337 (596)
Q Consensus       258 ~~~~yd~~g~~~~~~~~~~~ap~~~~~~~~~r~~~i~~~i~~~~~~g~dGi~ld~e~p~~~~~~~~~~~~~~~~~~~~~~  337 (596)
                                                                                                      
T Consensus       160 --------------------------------------------------------------------------------  159 (413)
T cd02873         160 --------------------------------------------------------------------------------  159 (413)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cCCCCCCCccChHHHHHHHHHHHHHhccCCcEEEEEEcCCcCcccccChhhHhhhccEeEEecccCCCCCCCCCCCCCCC
Q psy11626        338 TGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSA  417 (596)
Q Consensus       338 ~g~~~~~~~~d~~~f~~flkelr~~l~~~~~~Ls~av~~~~~~~~~~d~~~i~~~vD~i~vM~YD~~~~~~~~~~~g~~a  417 (596)
                         .++..++|+++|+.||+|||++|++.+++|+++|++.......||+++|+++|||||||+||+|++|..+..++|+|
T Consensus       160 ---~~~~~~~d~~nf~~Ll~elr~~l~~~~~~ls~av~~~~~~~~~~d~~~l~~~vD~inlMtYD~~g~~~~~~~~~~~a  236 (413)
T cd02873         160 ---VDEKAAEHKEQFTALVRELKNALRPDGLLLTLTVLPHVNSTWYFDVPAIANNVDFVNLATFDFLTPERNPEEADYTA  236 (413)
T ss_pred             ---cCCCChhHHHHHHHHHHHHHHHhcccCcEEEEEecCCchhccccCHHHHhhcCCEEEEEEecccCCCCCCCccCcCC
Confidence               01112446666666666666666666667777666543333468999999999999999999999998877899999


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHcCCCCCcEEEeeecceeeeeeccCCCCCCCCC-cccCCCCCCCCccCCCCcchHHHH
Q psy11626        418 PLHFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLEESSHKSGIPP-LVADGAGEKGTITKEEGLLSYAEI  496 (596)
Q Consensus       418 PL~~~~~~~~~~sv~~~v~~~~~~Gvp~~KLvlGvp~YG~~~~~~~~~~~~g~~~-~~~~g~~~~g~~t~~~g~l~Y~~i  496 (596)
                      ||+......+..||+.+|++|+++|+|++|||||||+|||.|++.+.....|.+. +.+.|++.+|+++.++|.++|.||
T Consensus       237 pL~~~~~~~~~~~v~~~v~~~~~~gvp~~KlvlGip~YGr~w~l~~~~~~~g~~~~~~~~g~~~~G~~~~~~g~l~y~ei  316 (413)
T cd02873         237 PIYELYERNPHHNVDYQVKYWLNQGTPASKLNLGIATYGRAWKLTKDSGITGVPPVLETDGPGPAGPQTKTPGLLSWPEI  316 (413)
T ss_pred             ccCCCccccccccHHHHHHHHHHcCCCHHHeEEEEecceeeeEccCCCCCcCCCCCccCCCCCCCCCCcCCCccccHHHH
Confidence            9997654445679999999999999999999999999999999987654445443 346788999999999999999999


Q ss_pred             hhhhccCCccCCCCCCceeccCcccccceeeEecccccccCCCCEEEEeCCHHHHHHHHHHHHHcCCceEEEEeCCCCCC
Q psy11626        497 CPQLVSITNAQASPSLLRKQEDPQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDF  576 (596)
Q Consensus       497 ~~~~~~~~~~~g~~~~~~~~~D~~~~~~~y~~~~~~~~~~~~~~~~isydd~~Sl~~K~~~a~~~gLgGv~~W~l~~DD~  576 (596)
                      |..+....+..|....|+.+||+..+.++|+|...+++  ..+++||+|||++|++.|++||+++||||+|+|++++||+
T Consensus       317 ~~~~~~~~~~~g~~~~~~~~~d~~~~~~~y~y~~~d~~--~~~~~wvsydd~~Si~~K~~y~~~~gLgGv~~W~l~~DD~  394 (413)
T cd02873         317 CSKLPNPANLKGADAPLRKVGDPTKRFGSYAYRPADEN--GEHGIWVSYEDPDTAANKAGYAKAKGLGGVALFDLSLDDF  394 (413)
T ss_pred             HHhhccCccccccccceeEeecccccccceEEeccccC--CCCCeEEEeCCHHHHHHHHHHHHhCCCceEEEEeeecCcC
Confidence            99876543222333346778898765568998754321  2347899999999999999999999999999999999999


Q ss_pred             CCCCCCCCchHHHHHHhhc
Q psy11626        577 RGMCNSNKFPILRAARTQF  595 (596)
Q Consensus       577 ~g~c~~~~~pLl~ai~~~l  595 (596)
                      +|.|+.++||||+||+..|
T Consensus       395 ~g~c~~~~~pll~~i~~~~  413 (413)
T cd02873         395 RGQCTGDKFPILRSAKYRL  413 (413)
T ss_pred             CCCcCCCCChHHHHHHhhC
Confidence            9999878999999999875

The IDGF's have an eight-stranded alpha/beta barrel fold and are related to the glycosyl hydrolase family 18 (GH18) chitinases, but they have an amino acid substitution known to abolish chitinase catalytic activity. IDGFs may have evolved from chitinases to gain new functions as growth factors, interacting with cell surface glycoproteins involved in growth-promoting processes.
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>KOG2806|consensus Back     alignment and domain information
>COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02878 GH18_zymocin_alpha Zymocin, alpha subunit Back     alignment and domain information
>smart00636 Glyco_18 Glycosyl hydrolase family 18 Back     alignment and domain information
>cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain Back     alignment and domain information
>cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods Back     alignment and domain information
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L Back     alignment and domain information
>cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii Back     alignment and domain information
>COG3858 Predicted glycosyl hydrolase [General function prediction only] Back     alignment and domain information
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) Back     alignment and domain information
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins Back     alignment and domain information
>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain Back     alignment and domain information
>cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain Back     alignment and domain information
>KOG2091|consensus Back     alignment and domain information
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins Back     alignment and domain information
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>COG3469 Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain Back     alignment and domain information
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome Back     alignment and domain information
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>cd02878 GH18_zymocin_alpha Zymocin, alpha subunit Back     alignment and domain information
>COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L Back     alignment and domain information
>PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>smart00636 Glyco_18 Glycosyl hydrolase family 18 Back     alignment and domain information
>cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii Back     alignment and domain information
>KOG2806|consensus Back     alignment and domain information
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) Back     alignment and domain information
>cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods Back     alignment and domain information
>cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins Back     alignment and domain information
>COG3469 Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3858 Predicted glycosyl hydrolase [General function prediction only] Back     alignment and domain information
>KOG4701|consensus Back     alignment and domain information
>cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>PF03644 Glyco_hydro_85: Glycosyl hydrolase family 85 ; InterPro: IPR005201 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF11340 DUF3142: Protein of unknown function (DUF3142); InterPro: IPR021488 This bacterial family of proteins has no known function Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins Back     alignment and domain information
>PF11340 DUF3142: Protein of unknown function (DUF3142); InterPro: IPR021488 This bacterial family of proteins has no known function Back     alignment and domain information
>TIGR01370 cysRS possible cysteinyl-tRNA synthetase, Methanococcus type Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>PF03644 Glyco_hydro_85: Glycosyl hydrolase family 85 ; InterPro: IPR005201 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG2091|consensus Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>PF14883 GHL13: Hypothetical glycosyl hydrolase family 13 Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PF02065 Melibiase: Melibiase; InterPro: IPR000111 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>TIGR00542 hxl6Piso_put hexulose-6-phosphate isomerase, putative Back     alignment and domain information
>PF13199 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 3VMO_A 3VMN_A 3VMP_A Back     alignment and domain information
>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase Back     alignment and domain information
>cd06595 GH31_xylosidase_XylS-like This family represents an uncharacterized glycosyl hydrolase family 31 (GH31) enzyme found in bacteria and eukaryotes that is related to the XylS xylosidase of Sulfolobus solfataricus Back     alignment and domain information
>KOG4701|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query596
1jnd_A420 Crystal Structure Of Imaginal Disc Growth Factor-2 3e-68
1guv_A366 Structure Of Human Chitotriosidase Length = 366 8e-34
1hkk_A364 High Resoultion Crystal Structure Of Human Chitinas 2e-33
1hki_A365 Crystal Structure Of Human Chitinase In Complex Wit 2e-33
1lg1_A365 Crystal Structure Of Human Chitotriosidase In Compl 2e-33
1waw_A445 Specificity And Affinity Of Natural Product Cyclope 4e-33
2esc_A361 Crystal Structure Of A 40 Kda Protective Signalling 6e-30
1ljy_A361 Crystal Structure Of A Novel Regulatory 40 Kda Mamm 2e-29
1syt_A361 Crystal Structure Of Signalling Protein From Goat S 5e-29
1sr0_A361 Crystal Structure Of Signalling Protein From Sheep( 7e-29
1zbv_A361 Crystal Structure Of The Goat Signalling Protein (S 7e-29
1xhg_A361 Crystal Structure Of A 40 Kda Signalling Protein Fr 7e-29
2pi6_A361 Crystal Structure Of The Sheep Signalling Glycoprot 8e-29
1owq_A361 Crystal Structure Of A 40 Kda Signalling Protein (S 2e-28
1tfv_A361 Crystal Structure Of A Buffalo Signaling Glycoprote 1e-27
1hjv_A362 Crystal Structure Of Hcgp-39 In Complex With Chitin 2e-26
4ay1_A365 Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch 3e-23
1e9l_A377 The Crystal Structure Of Novel Mammalian Lectin Ym1 3e-23
2ybt_A381 Crystal Structure Of Human Acidic Chitinase In Comp 5e-23
3fxy_A395 Acidic Mammalian Chinase, Catalytic Domain Length = 5e-23
3alf_A353 Crystal Structure Of Class V Chitinase From Nicotia 2e-19
3alg_A353 Crystal Structure Of Class V Chitinase (E115q Mutan 5e-19
3aqu_A356 Crystal Structure Of A Class V Chitinase From Arabi 7e-16
1itx_A419 Catalytic Domain Of Chitinase A1 From Bacillus Circ 1e-14
1wno_A395 Crystal Structure Of A Native Chitinase From Asperg 9e-11
1ur9_A499 Interactions Of A Family 18 Chitinase With The Desi 1e-10
1ur9_A499 Interactions Of A Family 18 Chitinase With The Desi 2e-07
1ogb_A499 Chitinase B From Serratia Marcescens Mutant D142n L 1e-10
1ogb_A499 Chitinase B From Serratia Marcescens Mutant D142n L 2e-07
1e15_A499 Chitinase B From Serratia Marcescens Length = 499 1e-10
1e15_A499 Chitinase B From Serratia Marcescens Length = 499 3e-07
1e6z_A498 Chitinase B From Serratia Marcescens Wildtype In Co 1e-10
1e6z_A498 Chitinase B From Serratia Marcescens Wildtype In Co 3e-07
1h0g_A499 Complex Of A Chitinase With The Natural Product Cyc 2e-10
1h0g_A499 Complex Of A Chitinase With The Natural Product Cyc 3e-07
1e6n_B499 Chitinase B From Serratia Marcescens Inactive Mutan 3e-10
1e6n_B499 Chitinase B From Serratia Marcescens Inactive Mutan 6e-07
1w9p_A433 Specificity And Affinity Of Natural Product Cyclope 3e-10
1goi_A499 Crystal Structure Of The D140n Mutant Of Chitinase 5e-10
1goi_A499 Crystal Structure Of The D140n Mutant Of Chitinase 9e-07
3qok_A420 Crystal Structure Of Putative Chitinase Ii From Kle 2e-09
3qok_A420 Crystal Structure Of Putative Chitinase Ii From Kle 1e-06
3g6l_A406 The Crystal Structure Of A Chitinase Crchi1 From Th 2e-08
1ll6_A392 Structure Of The D169n Mutant Of C. Immitis Chitina 3e-08
1ll6_A392 Structure Of The D169n Mutant Of C. Immitis Chitina 8e-06
1d2k_A392 C. Immitis Chitinase 1 At 2.2 Angstroms Resolution 4e-08
1d2k_A392 C. Immitis Chitinase 1 At 2.2 Angstroms Resolution 1e-05
1ll7_A392 Structure Of The E171q Mutant Of C. Immitis Chitina 9e-08
1ll7_A392 Structure Of The E171q Mutant Of C. Immitis Chitina 2e-05
1eib_A540 Crystal Structure Of Chitinase A Mutant D313a Compl 5e-06
1rd6_A563 Crystal Structure Of S. Marcescens Chitinase A Muta 2e-05
2wk2_A540 Chitinase A From Serratia Marcescens Atcc990 In Com 2e-05
2wly_A548 Chitinase A From Serratia Marcescens Atcc990 In Com 2e-05
1edq_A540 Crystal Structure Of Chitinase A From S. Marcescens 3e-05
1ctn_A540 Crystal Structure Of A Bacterial Chitinase At 2.3 A 3e-05
3ars_A584 Crystal Structure Analysis Of Chitinase A From Vibr 3e-05
3b8s_A584 Crystal Structure Of Wild-Type Chitinase A From Vib 4e-05
1ehn_A540 Crystal Structure Of Chitinase A Mutant E315q Compl 6e-05
1ffr_A540 Crystal Structure Of Chitinase A Mutant Y390f Compl 7e-05
1nh6_A540 Structure Of S. Marcescens Chitinase A, E315l, Comp 2e-04
1k9t_A540 Chitinase A Complexed With Tetra-N-Acetylchitotrios 2e-04
3b9a_A584 Crystal Structure Of Vibrio Harveyi Chitinase A Com 3e-04
>pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 Back     alignment and structure 
Iteration: 1

 Score =  256 bits (653), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 135/322 (41%), Positives = 201/322 (62%), Gaps = 11/322 (3%)
Query: 280 LHFLDDPKYRK-SFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVT 338
           +  L+  K R+  FI +    +K YGF+GLDLA++FP    +     LG  W  IKK  T
Sbjct: 98  IDLLEGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVHGDLGLAWKSIKKLFT 157
Query: 339 GP--KDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMI 396
           G    D +  LH+E FT L+R++K + RA+ FLLS +VLP+VN T YFD+P++   +D +
Sbjct: 158 GDFIVDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFV 217
Query: 397 TLHAYDFRTPQRNPKEADYSAPLHFVYG---RVPHQNANAMVRWFIEHGVELQKLVLGIP 453
            L  +DF TP RNP+EADYSAP++   G   R+ H NA+  V +++  G    K+ LG+ 
Sbjct: 218 NLATFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVA 277
Query: 454 TFGRSWLLEESSHKSGIPPLV-ADGAGEKGTITKEEGLLSYAEICPQLVSITNA--QASP 510
           T+G +W L + S   G+P +    G   +G  +++ GLLSYAEIC +L +  N   + + 
Sbjct: 278 TYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNE 337
Query: 511 SLLRKQEDPQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIID 570
           S LR+  DP +R G  A+R  D ++ +  G WVS+++P++A  KA+YA++  LGGVA+ D
Sbjct: 338 SPLRRVSDPTKRFGGIAYRPVDGQITE--GIWVSYDDPDSASNKAAYARVKNLGGVALFD 395
Query: 571 LSLDDFRGMCNSNKFPILRAAR 592
           LS DDFRG C+ +K+PILRA +
Sbjct: 396 LSYDDFRGQCSGDKYPILRAIK 417
>pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 Back     alignment and structure
>pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 Back     alignment and structure
>pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 Back     alignment and structure
>pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 Back     alignment and structure
>pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 Back     alignment and structure
>pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 Back     alignment and structure
>pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 Back     alignment and structure
>pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 Back     alignment and structure
>pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 Back     alignment and structure
>pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 Back     alignment and structure
>pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 Back     alignment and structure
>pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 Back     alignment and structure
>pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 Back     alignment and structure
>pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 Back     alignment and structure
>pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 Back     alignment and structure
>pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 Back     alignment and structure
>pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 Back     alignment and structure
>pdb|3ALF|A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum Length = 353 Back     alignment and structure
>pdb|3ALG|A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4 Length = 353 Back     alignment and structure
>pdb|3AQU|A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana Length = 356 Back     alignment and structure
>pdb|1ITX|A Chain A, Catalytic Domain Of Chitinase A1 From Bacillus Circulans Wl-12 Length = 419 Back     alignment and structure
>pdb|1WNO|A Chain A, Crystal Structure Of A Native Chitinase From Aspergillus Fumigatus Yj- 407 Length = 395 Back     alignment and structure
>pdb|1UR9|A Chain A, Interactions Of A Family 18 Chitinase With The Designed Inhibitor Hm508, And Its Degradation Product, Chitobiono-Delta-Lactone Length = 499 Back     alignment and structure
>pdb|1UR9|A Chain A, Interactions Of A Family 18 Chitinase With The Designed Inhibitor Hm508, And Its Degradation Product, Chitobiono-Delta-Lactone Length = 499 Back     alignment and structure
>pdb|1OGB|A Chain A, Chitinase B From Serratia Marcescens Mutant D142n Length = 499 Back     alignment and structure
>pdb|1OGB|A Chain A, Chitinase B From Serratia Marcescens Mutant D142n Length = 499 Back     alignment and structure
>pdb|1E15|A Chain A, Chitinase B From Serratia Marcescens Length = 499 Back     alignment and structure
>pdb|1E15|A Chain A, Chitinase B From Serratia Marcescens Length = 499 Back     alignment and structure
>pdb|1E6Z|A Chain A, Chitinase B From Serratia Marcescens Wildtype In Complex With Catalytic Intermediate Length = 498 Back     alignment and structure
>pdb|1E6Z|A Chain A, Chitinase B From Serratia Marcescens Wildtype In Complex With Catalytic Intermediate Length = 498 Back     alignment and structure
>pdb|1H0G|A Chain A, Complex Of A Chitinase With The Natural Product Cyclopentapeptide Argadin From Clonostachys Length = 499 Back     alignment and structure
>pdb|1H0G|A Chain A, Complex Of A Chitinase With The Natural Product Cyclopentapeptide Argadin From Clonostachys Length = 499 Back     alignment and structure
>pdb|1E6N|B Chain B, Chitinase B From Serratia Marcescens Inactive Mutant E144q In Complex With N-Acetylglucosamine-Pentamer Length = 499 Back     alignment and structure
>pdb|1E6N|B Chain B, Chitinase B From Serratia Marcescens Inactive Mutant E144q In Complex With N-Acetylglucosamine-Pentamer Length = 499 Back     alignment and structure
>pdb|1W9P|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human And Bacterial Chitinasefra Length = 433 Back     alignment and structure
>pdb|1GOI|A Chain A, Crystal Structure Of The D140n Mutant Of Chitinase B From Serratia Marcescens At 1.45 A Resolution Length = 499 Back     alignment and structure
>pdb|1GOI|A Chain A, Crystal Structure Of The D140n Mutant Of Chitinase B From Serratia Marcescens At 1.45 A Resolution Length = 499 Back     alignment and structure
>pdb|3QOK|A Chain A, Crystal Structure Of Putative Chitinase Ii From Klebsiella Pneumoniae Length = 420 Back     alignment and structure
>pdb|3QOK|A Chain A, Crystal Structure Of Putative Chitinase Ii From Klebsiella Pneumoniae Length = 420 Back     alignment and structure
>pdb|3G6L|A Chain A, The Crystal Structure Of A Chitinase Crchi1 From The Nematophagous Fungus Clonostachys Rosea Length = 406 Back     alignment and structure
>pdb|1LL6|A Chain A, Structure Of The D169n Mutant Of C. Immitis Chitinase 1 Length = 392 Back     alignment and structure
>pdb|1LL6|A Chain A, Structure Of The D169n Mutant Of C. Immitis Chitinase 1 Length = 392 Back     alignment and structure
>pdb|1D2K|A Chain A, C. Immitis Chitinase 1 At 2.2 Angstroms Resolution Length = 392 Back     alignment and structure
>pdb|1D2K|A Chain A, C. Immitis Chitinase 1 At 2.2 Angstroms Resolution Length = 392 Back     alignment and structure
>pdb|1LL7|A Chain A, Structure Of The E171q Mutant Of C. Immitis Chitinase 1 Length = 392 Back     alignment and structure
>pdb|1LL7|A Chain A, Structure Of The E171q Mutant Of C. Immitis Chitinase 1 Length = 392 Back     alignment and structure
>pdb|1EIB|A Chain A, Crystal Structure Of Chitinase A Mutant D313a Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 Back     alignment and structure
>pdb|1RD6|A Chain A, Crystal Structure Of S. Marcescens Chitinase A Mutant W167a Length = 563 Back     alignment and structure
>pdb|2WK2|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline Dithioamide Length = 540 Back     alignment and structure
>pdb|2WLY|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline. Length = 548 Back     alignment and structure
>pdb|1EDQ|A Chain A, Crystal Structure Of Chitinase A From S. Marcescens At 1.55 Angstroms Length = 540 Back     alignment and structure
>pdb|1CTN|A Chain A, Crystal Structure Of A Bacterial Chitinase At 2.3 Angstroms Resolution Length = 540 Back     alignment and structure
>pdb|3ARS|A Chain A, Crystal Structure Analysis Of Chitinase A From Vibrio Harveyi With Novel Inhibitors - Apo Structure Of Mutant W275g Length = 584 Back     alignment and structure
>pdb|3B8S|A Chain A, Crystal Structure Of Wild-Type Chitinase A From Vibrio Harveyi Length = 584 Back     alignment and structure
>pdb|1EHN|A Chain A, Crystal Structure Of Chitinase A Mutant E315q Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 Back     alignment and structure
>pdb|1FFR|A Chain A, Crystal Structure Of Chitinase A Mutant Y390f Complexed With Hexa-n- Acetylchitohexaose (nag)6 Length = 540 Back     alignment and structure
>pdb|1NH6|A Chain A, Structure Of S. Marcescens Chitinase A, E315l, Complex With Hexasaccharide Length = 540 Back     alignment and structure
>pdb|1K9T|A Chain A, Chitinase A Complexed With Tetra-N-Acetylchitotriose Length = 540 Back     alignment and structure
>pdb|3B9A|A Chain A, Crystal Structure Of Vibrio Harveyi Chitinase A Complexed With Hexasaccharide Length = 584 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query596
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 4e-92
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 3e-61
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 2e-73
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 1e-44
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 2e-66
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 4e-42
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 1e-65
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 1e-42
1wb0_A445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 9e-64
1wb0_A445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 6e-42
3fy1_A395 Amcase, TSA1902, acidic mammalian chitinase; struc 2e-60
3fy1_A395 Amcase, TSA1902, acidic mammalian chitinase; struc 3e-38
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 2e-55
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 4e-35
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 5e-53
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 2e-35
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 8e-49
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 2e-35
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 4e-44
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 2e-30
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 5e-41
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 3e-27
1goi_A499 Chitinase B; chitin degradation, hydrolase, glycos 1e-39
1goi_A499 Chitinase B; chitin degradation, hydrolase, glycos 1e-34
3oa5_A574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 6e-39
3oa5_A574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 3e-30
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 6e-39
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 5e-28
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 8e-39
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 1e-31
1w9p_A433 Chitinase; peptide inhibitors, argifin, argadin, g 1e-38
1w9p_A433 Chitinase; peptide inhibitors, argifin, argadin, g 5e-33
3g6m_A406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 2e-38
3g6m_A406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 1e-31
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 1e-37
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 7e-25
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 1e-35
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 8e-25
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 4e-33
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 4e-27
3sim_A275 Protein, family 18 chitinase; family 18 plant chit 3e-29
3sim_A275 Protein, family 18 chitinase; family 18 plant chit 8e-27
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 1e-22
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 4e-19
1edt_A271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 1e-18
1edt_A271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 3e-11
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 3e-14
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 5e-10
1nar_A290 Narbonin; plant SEED protein; 1.80A {Vicia narbone 4e-12
2y8v_A290 CHIC, class III chitinase, putative; afchic, hydro 8e-12
2y8v_A290 CHIC, class III chitinase, putative; afchic, hydro 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2ebn_A289 Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl 8e-10
2ebn_A289 Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl 2e-05
3poh_A451 Endo-beta-N-acetylglucosaminidase F1; TIM barrel, 1e-06
3poh_A451 Endo-beta-N-acetylglucosaminidase F1; TIM barrel, 2e-05
3ian_A321 Chitinase; structural genomics, hydrolase, glycosi 1e-06
3ian_A321 Chitinase; structural genomics, hydrolase, glycosi 8e-05
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 Back     alignment and structure
 Score =  289 bits (740), Expect = 4e-92
 Identities = 131/312 (41%), Positives = 194/312 (62%), Gaps = 10/312 (3%)

Query: 289 RKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTG--PKDDNPT 346
           +  FI +    +K YGF+GLDLA++FP    +     LG  W  IKK  TG    D +  
Sbjct: 108 QIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVHGDLGLAWKSIKKLFTGDFIVDPHAA 167

Query: 347 LHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTP 406
           LH+E FT L+R++K + RA+ FLLS +VLP+VN T YFD+P++   +D + L  +DF TP
Sbjct: 168 LHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTP 227

Query: 407 QRNPKEADYSAPL---HFVYGRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLEE 463
            RNP+EADYSAP+        R+ H NA+  V +++  G    K+ LG+ T+G +W L +
Sbjct: 228 ARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTK 287

Query: 464 SSHKSGIPPL-VADGAGEKGTITKEEGLLSYAEICPQLVSITNA--QASPSLLRKQEDPQ 520
            S   G+P +    G   +G  +++ GLLSYAEIC +L +  N   + + S LR+  DP 
Sbjct: 288 DSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPT 347

Query: 521 RRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLDDFRGMC 580
           +R G  A+R  D ++ +  G WVS+++P++A  KA+YA++  LGGVA+ DLS DDFRG C
Sbjct: 348 KRFGGIAYRPVDGQITE--GIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQC 405

Query: 581 NSNKFPILRAAR 592
           + +K+PILRA +
Sbjct: 406 SGDKYPILRAIK 417
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 Back     alignment and structure
>1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 Back     alignment and structure
>2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 Back     alignment and structure
>3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Length = 451 Back     alignment and structure
>3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Length = 451 Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query596
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 100.0
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 100.0
3fy1_A395 Amcase, TSA1902, acidic mammalian chitinase; struc 100.0
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 100.0
1wb0_A445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 100.0
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 100.0
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 100.0
3g6m_A406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 100.0
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 100.0
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 100.0
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 100.0
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 100.0
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 100.0
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 100.0
1goi_A499 Chitinase B; chitin degradation, hydrolase, glycos 100.0
1w9p_A433 Chitinase; peptide inhibitors, argifin, argadin, g 100.0
3oa5_A574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 100.0
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 100.0
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 100.0
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 100.0
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 100.0
1nar_A290 Narbonin; plant SEED protein; 1.80A {Vicia narbone 100.0
2y8v_A290 CHIC, class III chitinase, putative; afchic, hydro 100.0
4axn_A328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 100.0
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 100.0
3sim_A275 Protein, family 18 chitinase; family 18 plant chit 100.0
3ian_A321 Chitinase; structural genomics, hydrolase, glycosi 100.0
3ebv_A302 Chinitase A; chitinase A, CHIA, glycosidase, struc 100.0
4ac1_X283 Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g 99.98
1edt_A271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 99.97
2ebn_A289 Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl 99.94
2hvm_A273 Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He 99.94
2gsj_A271 Protein PPL-2; mimosoideae, chimerolectin, endochi 99.93
2uy2_A294 Endochitinase; carbohydrate metabolism, polysaccha 99.92
1eok_A290 Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b 99.92
2xtk_A310 CHIA1, class III chitinase CHIA1; hydrolase, GH18; 99.91
1cnv_A299 Concanavalin B; plant chitinase, chitin binding pr 99.9
3poh_A451 Endo-beta-N-acetylglucosaminidase F1; TIM barrel, 99.83
1ta3_A274 XIP-1, xylanase inhibitor protein I; beta alpha ba 99.82
2dsk_A311 Chitinase; catalytic domain, active domain, crysta 99.66
3mu7_A273 XAIP-II, xylanase and alpha-amylase inhibitor prot 99.63
1jnd_A420 Imaginal DISC growth factor-2; IDGF, chitinase, in 99.37
2ebn_A289 Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl 99.36
3poh_A451 Endo-beta-N-acetylglucosaminidase F1; TIM barrel, 99.29
2y8v_A290 CHIC, class III chitinase, putative; afchic, hydro 99.29
1kfw_A435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 99.27
1itx_A419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 99.19
1wb0_A445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 99.18
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 99.17
1vf8_A377 YM1, secretory protein; chitinase, CHI-lectin, str 99.17
3arx_A584 Chitinase A; TIM barrel, inhibitor complex, glycos 99.16
3qok_A420 Putative chitinase II; structural genomics, PSI-bi 99.12
3fy1_A395 Amcase, TSA1902, acidic mammalian chitinase; struc 99.03
3oa5_A574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 99.01
2dsk_A311 Chitinase; catalytic domain, active domain, crysta 99.01
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 98.98
3g6m_A406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 98.94
1ll7_A392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 98.93
3bxw_B393 Chitinase domain-containing protein 1; TIM barrel, 98.93
1w9p_A433 Chitinase; peptide inhibitors, argifin, argadin, g 98.91
2pi6_A361 Chitinase-3-like protein 1; complex, signaling pro 98.89
1goi_A499 Chitinase B; chitin degradation, hydrolase, glycos 98.85
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 98.77
3mu7_A273 XAIP-II, xylanase and alpha-amylase inhibitor prot 98.72
3sim_A275 Protein, family 18 chitinase; family 18 plant chit 98.71
3alf_A353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 98.7
4ay1_A365 Chitinase-3-like protein 2; chilectin, lectin, chi 98.7
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 98.64
1nar_A290 Narbonin; plant SEED protein; 1.80A {Vicia narbone 98.6
3aqu_A356 AT4G19810; stress response, TIM barrel, hydrolase, 98.56
3ebv_A302 Chinitase A; chitinase A, CHIA, glycosidase, struc 98.5
3ian_A321 Chitinase; structural genomics, hydrolase, glycosi 98.44
4axn_A328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 98.44
1edt_A271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 98.43
4ac1_X283 Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g 98.33
2hvm_A273 Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He 98.2
2gsj_A271 Protein PPL-2; mimosoideae, chimerolectin, endochi 98.17
2uy2_A294 Endochitinase; carbohydrate metabolism, polysaccha 98.15
2xtk_A310 CHIA1, class III chitinase CHIA1; hydrolase, GH18; 98.14
1eok_A290 Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b 98.13
1ta3_A274 XIP-1, xylanase inhibitor protein I; beta alpha ba 98.08
1cnv_A299 Concanavalin B; plant chitinase, chitin binding pr 97.99
2vtf_A626 Endo-beta-N-acetylglucosaminidase; hydrolase, fami 96.88
2w91_A653 Endo-beta-N-acetylglucosaminidase D; hydrolase, N- 96.64
2vtf_A 626 Endo-beta-N-acetylglucosaminidase; hydrolase, fami 94.73
2w91_A 653 Endo-beta-N-acetylglucosaminidase D; hydrolase, N- 94.64
2aam_A309 Hypothetical protein TM1410; structural genomics, 91.83
3mi6_A745 Alpha-galactosidase; NESG, structural genomics, PS 88.17
3vmn_A643 Dextranase; TIM barrel, immunoglobrin fold, greek- 87.14
3ngf_A269 AP endonuclease, family 2; structural genomics, se 86.97
2wnw_A447 Activated by transcription factor SSRB; hydrolase, 85.72
4f9d_A618 Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas; 85.62
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 84.85
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 84.38
1zy9_A564 Alpha-galactosidase; TM1192, struc genomics, joint 83.1
2xn2_A732 Alpha-galactosidase; hydrolase, glycosidase; HET: 82.78
3kws_A287 Putative sugar isomerase; structural genomics, joi 82.76
2yfo_A720 Alpha-galactosidase-sucrose kinase agask; hydrolas 81.34
2nt0_A497 Glucosylceramidase; cerezyme, glucocerebrosidase, 81.02
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 81.01
3vni_A294 Xylose isomerase domain protein TIM barrel; D-psic 80.1
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Back     alignment and structure
Probab=100.00  E-value=7.8e-77  Score=643.29  Aligned_cols=410  Identities=40%  Similarity=0.740  Sum_probs=316.9

Q ss_pred             CCceeEeeeeeeecCCCCCCCCCCcCCCCCcccEEEEEEEEecCCCceEEecCCccccccccchhhhHHHHHHHhhhCCC
Q psy11626         20 KDQYHIHSNLYFISSGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSLDKELDTDKNKGKELFKQITALKTFQPN   99 (596)
Q Consensus        20 ~~~~~~~~~~~~~~~g~~~~~~~~i~~~~~~~Thviyafa~v~~~g~~~~~~~~~~~d~~~~~~~~~~~~~~~lk~~~p~   99 (596)
                      +.++|||++|+++|++..+|.+++|++.+++||||+|||+.|+.+ ++++...+++.|..    .+.+++|.+||+++|+
T Consensus         2 ~~vvgYy~~w~~~r~~~~~~~~~~i~~~~~~~THi~yaFa~i~~~-~~~~~~~d~~~d~~----~~~~~~~~~lk~~~p~   76 (420)
T 1jnd_A            2 SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGE-NLQAYSMNENLDIY----KHQFSEVTSLKRKYPH   76 (420)
T ss_dssp             CEEEEEEEGGGGGCSSTTCCCHHHHHHHGGGCSEEEEEEEEECTT-TCCEEETTHHHHTT----TCHHHHHHGGGGTSTT
T ss_pred             CeEEEEEccchhcCCCCCCcCHhHcCCccccCCEEEEEEEEecCC-CCEEEecCccchhh----hHHHHHHHHHHhhCCC
Confidence            467899999999999999999999997668999999999999954 34555555433332    5688999999999999


Q ss_pred             ceEEEEEcCCCCCC--ChhhhhhhcCCHHHH-HHHHHHHHHHHHHhCCCeeeeeccCCCcCccccccccccchhcccccc
Q psy11626        100 LNIMLSVGGFEDDD--DKEKYLEVLDDPKYR-KSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTV  176 (596)
Q Consensus       100 lkvllsiGG~~~~~--~s~~f~~~~~~~~~r-~~f~~si~~~l~~~gfDGvdiDwE~p~~~~~~~~~~~~~~~~~~~~~~  176 (596)
                      +|||||||||+...  ++..|+.++++++.| ++||++|++||++|||||||||||||...+....+.+|++|+.+++.+
T Consensus        77 lKvllsiGGw~~~~~~~s~~f~~~~~~~~~R~~~Fi~s~v~~~~~~gfDGiDiDwEyP~~~~~~~~g~~g~~~~~~~~~~  156 (420)
T 1jnd_A           77 LKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVHGDLGLAWKSIKKLF  156 (420)
T ss_dssp             CEEEEEEETTCCCCTTSTTHHHHHHTCCHHHHHHHHHHHHHHHHHTTCSEEEEECCCCCCCCCCC---------------
T ss_pred             ceEEEEeCCCcCCCCccchhhhHhhcChHHHHHHHHHHHHHHHHHcCCCceEEeeecCCccccccccccccccccccccc
Confidence            99999999998631  157899999999999 999999999999999999999999998765433455666676655444


Q ss_pred             cCCCCCCCccchHHHHHHHHHHHHHhhhcCcEEEEEecCCcccccccchhhhhcccceeeeeccccccCCcccccccccc
Q psy11626        177 TGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFLYFDVPSITQHLDM  256 (596)
Q Consensus       177 ~g~~~~~~~~d~~~~~~ll~~Lr~~l~~~~~~ls~av~~~~~~~~~~~~~~~~~~~d~i~~m~Yd~~~~~~~~~~~~~d~  256 (596)
                      .|...                                                                           
T Consensus       157 ~g~~~---------------------------------------------------------------------------  161 (420)
T 1jnd_A          157 TGDFI---------------------------------------------------------------------------  161 (420)
T ss_dssp             ----C---------------------------------------------------------------------------
T ss_pred             cCCcc---------------------------------------------------------------------------
Confidence            33210                                                                           


Q ss_pred             cccccccCCCCCCCCCCCCCCCCcccCCChHHHHHHHHHHHHHHHHhCCCccceeeecCcccCCccccccccceeccccc
Q psy11626        257 ITLHAYDFRTPQRNPKEADYSAPLHFLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKT  336 (596)
Q Consensus       257 ~~~~~yd~~g~~~~~~~~~~~ap~~~~~~~~~r~~~i~~~i~~~~~~g~dGi~ld~e~p~~~~~~~~~~~~~~~~~~~~~  336 (596)
                                                                                                      
T Consensus       162 --------------------------------------------------------------------------------  161 (420)
T 1jnd_A          162 --------------------------------------------------------------------------------  161 (420)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ccCCCCCCCccChHHHHHHHHHHHHHhccCCcEEEEEEcCCcCcccccChhhHhhhccEeEEecccCCCCCCCCCCCCCC
Q psy11626        337 VTGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYS  416 (596)
Q Consensus       337 ~~g~~~~~~~~d~~~f~~flkelr~~l~~~~~~Ls~av~~~~~~~~~~d~~~i~~~vD~i~vM~YD~~~~~~~~~~~g~~  416 (596)
                          .++..++|+.+|+.||+|||++|++.+++||++|++.......+|+++|.++|||||||+||+||+|+.+..++|+
T Consensus       162 ----~~~~~~~d~~nf~~ll~eLr~~l~~~~~~Ls~av~~~~~~~~~~d~~~l~~~vD~inlMtYD~~g~~~~~~~~g~~  237 (420)
T 1jnd_A          162 ----VDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYS  237 (420)
T ss_dssp             ----CCTTHHHHHHHHHHHHHHHHHHHHTTTCEEEEEECTTCCHHHHCCHHHHHTTCSEEEECCCCSSCTTTCTTCBCCS
T ss_pred             ----cccCChhHHHHHHHHHHHHHHHHhhcCcEEEEEEeCCcchhhccCHHHHHhhCcEEEEeeeecCCCcCCCCccccC
Confidence                0111234555555555555555555556666666554433446899999999999999999999999877789999


Q ss_pred             CCCCCCC---CCCCCCCHHHHHHHHHHcCCCCCcEEEeeecceeeeeeccCCCCCCCCCc-ccCCCCCCCCccCCCCcch
Q psy11626        417 APLHFVY---GRVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLEESSHKSGIPPL-VADGAGEKGTITKEEGLLS  492 (596)
Q Consensus       417 aPL~~~~---~~~~~~sv~~~v~~~~~~Gvp~~KLvlGvp~YG~~~~~~~~~~~~g~~~~-~~~g~~~~g~~t~~~g~l~  492 (596)
                      |||+..+   ......|++.+|++|+++|+|++|||||||+|||+|++.+.++..|++.+ .+.|++.+|+++.++|.++
T Consensus       238 apl~~~~~~~~~~~~~~v~~~v~~~~~~gvp~~KlvlGip~YGr~w~~~~~~~~~g~~~~~~~~g~~~~g~~t~~~G~~~  317 (420)
T 1jnd_A          238 APIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLS  317 (420)
T ss_dssp             SCSSCCTTSTTCCTTCSHHHHHHHHHHTTCCGGGEEEEEESEEEEEECCGGGCSCCSSCBCSCCSBCCCCTTTCCTTEEE
T ss_pred             CcccCCccccCccccccHHHHHHHHHHcCCCHHHEEEEecccceeeEecCCCCCCCCCcccccCCCCCCCCCCCCCceee
Confidence            9999865   23456799999999999999999999999999999999876655566643 2578899999999999999


Q ss_pred             HHHHhhhhccCCcc--CCCCCCceeccCcccccceeeEecccccccCCCCEEEEeCCHHHHHHHHHHHHHcCCceEEEEe
Q psy11626        493 YAEICPQLVSITNA--QASPSLLRKQEDPQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIID  570 (596)
Q Consensus       493 Y~~i~~~~~~~~~~--~g~~~~~~~~~D~~~~~~~y~~~~~~~~~~~~~~~~isydd~~Sl~~K~~~a~~~gLgGv~~W~  570 (596)
                      |.|||..+...+..  .|....++.+||+....++|+|+..+.+  ..+++||+|||++|+++|++||+++||||+|+|+
T Consensus       318 y~ei~~~~~~~~~~~~~g~~~~~~~~~D~~~~~~~y~y~~~d~~--~~~~~wvsydd~~Si~~K~~y~~~~gLgGv~~W~  395 (420)
T 1jnd_A          318 YAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQ--ITEGIWVSYDDPDSASNKAAYARVKNLGGVALFD  395 (420)
T ss_dssp             HHHHHHHBCCTTTTTCCGGGSCBEEECCTTCCSCEEEEECSBTT--BCCCEEEEECCHHHHHHHHHHHHHTTCSEEEEEC
T ss_pred             HHHHHHhhcccCcccccccccceeEEechhhccceeEEEecccC--CCCCEEEEcCCHHHHHHHHHHHHhCCCceEEEEe
Confidence            99999988664321  0111235778898655679998754321  2458999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCchHHHHHHhhc
Q psy11626        571 LSLDDFRGMCNSNKFPILRAARTQF  595 (596)
Q Consensus       571 l~~DD~~g~c~~~~~pLl~ai~~~l  595 (596)
                      |++||++|.|++++||||+||+..|
T Consensus       396 l~~Dd~~g~c~~~~~pll~ai~~~l  420 (420)
T 1jnd_A          396 LSYDDFRGQCSGDKYPILRAIKYRL  420 (420)
T ss_dssp             GGGSCTTCTTTSCSSHHHHHHHHHC
T ss_pred             eccCCCCCccCCCCChHHHHHHhhC
Confidence            9999999999989999999999876
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Back     alignment and structure
>4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Back     alignment and structure
>2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Back     alignment and structure
>2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* Back     alignment and structure
>2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} Back     alignment and structure
>2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* Back     alignment and structure
>1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* Back     alignment and structure
>2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* Back     alignment and structure
>1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 Back     alignment and structure
>3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* Back     alignment and structure
>2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Back     alignment and structure
>3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} SCOP: c.1.8.0 PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* Back     alignment and structure
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Back     alignment and structure
>2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Back     alignment and structure
>3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Back     alignment and structure
>2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Back     alignment and structure
>3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} SCOP: c.1.8.0 PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Back     alignment and structure
>4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} Back     alignment and structure
>2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* Back     alignment and structure
>2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} Back     alignment and structure
>2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* Back     alignment and structure
>2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* Back     alignment and structure
>1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* Back     alignment and structure
>1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* Back     alignment and structure
>1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 Back     alignment and structure
>2vtf_A Endo-beta-N-acetylglucosaminidase; hydrolase, family 85, glycosidase, carbohydrat binding; HET: B3P PGE; 1.79A {Arthrobacter protophormiae} PDB: 3fhq_A* 3fha_A* Back     alignment and structure
>2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* Back     alignment and structure
>2vtf_A Endo-beta-N-acetylglucosaminidase; hydrolase, family 85, glycosidase, carbohydrat binding; HET: B3P PGE; 1.79A {Arthrobacter protophormiae} PDB: 3fhq_A* 3fha_A* Back     alignment and structure
>2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* Back     alignment and structure
>2aam_A Hypothetical protein TM1410; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE UNL; 2.20A {Thermotoga maritima} SCOP: c.1.8.15 Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure
>3vmn_A Dextranase; TIM barrel, immunoglobrin fold, greek-KEY-motif, glycoside H family 66, hydrolase; 1.60A {Streptococcus mutans} PDB: 3vmo_A* 3vmp_A* Back     alignment and structure
>3ngf_A AP endonuclease, family 2; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 1.80A {Brucella melitensis biovar abortus} SCOP: c.1.15.0 Back     alignment and structure
>2wnw_A Activated by transcription factor SSRB; hydrolase, salmonella typhimurium, O-glycosyl hydrolase family 30; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>4f9d_A Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas; family 4 carbohydrate esterase, TIM barrel, hydrolase, deace carbohydrate/sugar binding; HET: MES; 1.90A {Escherichia coli} PDB: 4f9j_A* Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 Back     alignment and structure
>2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* Back     alignment and structure
>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>2nt0_A Glucosylceramidase; cerezyme, glucocerebrosidase, glucosylceramide, hydrolysis, disease, hydrolase; HET: NAG; 1.79A {Homo sapiens} SCOP: b.71.1.2 c.1.8.3 PDB: 1y7v_A* 2f61_A* 2j25_A* 2nsx_A* 1ogs_A* 2nt1_A* 3gxd_A* 3gxf_A* 3gxi_A* 3gxm_A* 3rik_A* 3ril_A* 2v3f_A* 2v3e_A* 2v3d_A* 2vt0_A* 2wcg_A* 2xwd_A* 2xwe_A* 2wkl_A* ... Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 596
d1jnda1327 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f 1e-44
d1jnda1327 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f 2e-33
d1jnda1327 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f 4e-14
d1goia2356 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic 2e-24
d1goia2356 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic 3e-17
d1wb0a1297 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma 6e-24
d1wb0a1297 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma 1e-17
d1wb0a1297 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma 7e-11
d1w9pa1333 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil 4e-23
d1w9pa1333 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil 2e-21
d1edqa2358 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt 7e-23
d1edqa2358 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt 1e-22
d1vf8a1302 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin 1e-22
d1vf8a1302 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin 1e-18
d1vf8a1302 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin 5e-08
d1kfwa1374 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina 2e-22
d1kfwa1374 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina 2e-18
d1kfwa1374 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina 0.001
d1ll7a1330 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( 8e-22
d1ll7a1330 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( 1e-21
d1itxa1347 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu 3e-21
d1itxa1347 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu 1e-15
d1itxa1347 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu 2e-05
d1jnda292 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 3e-20
d2pi6a1292 c.1.8.5 (A:1-239,A:308-361) Signal processing prot 7e-20
d2pi6a1292 c.1.8.5 (A:1-239,A:308-361) Signal processing prot 6e-13
d2pi6a1292 c.1.8.5 (A:1-239,A:308-361) Signal processing prot 8e-10
d1nara_289 c.1.8.5 (A:) Seed storage protein {Vicia narbonens 6e-19
d1nara_289 c.1.8.5 (A:) Seed storage protein {Vicia narbonens 1e-08
d1edta_265 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St 5e-17
d1edta_265 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St 4e-11
d2ebna_285 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl 1e-14
d2ebna_285 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl 2e-09
d2hvma_273 c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para 4e-11
d2hvma_273 c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para 3e-05
d1eoka_282 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl 9e-09
d1eoka_282 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl 2e-06
d2pi6a268 d.26.3.1 (A:240-307) Signal processing protein (SP 3e-08
d1wb0a268 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo 2e-06
d1vf8a270 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mo 1e-05
d1ta3a_274 c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I { 1e-04
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Imaginal disc growth factor-2
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score =  159 bits (403), Expect = 1e-44
 Identities = 93/265 (35%), Positives = 141/265 (53%), Gaps = 24/265 (9%)

Query: 27  SNL--YFIS-----SGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSLDKELDTD 79
           SNL  Y+ S      G  K+   +L+ AL  C+HLVYG+AG+    +    S+++ LD  
Sbjct: 1   SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGL-RGENLQAYSMNENLDIY 59

Query: 80  KNKGKELFKQITALKTFQPNLNIMLSVGGFED--DDDKEKYLEVL-DDPKYRKSFIETTV 136
           K+     F ++T+LK   P+L ++LSVGG  D   D   KY+++L  +   +  FI +  
Sbjct: 60  KH----QFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAY 115

Query: 137 AALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVTG--PKDDNPTLHREHFTLL 194
             +K YGF+GLDLA++FP    +     LG  W  IKK  TG    D +  LH+E FT L
Sbjct: 116 ELVKTYGFDGLDLAYQFPKNKPRKVHGDLGLAWKSIKKLFTGDFIVDPHAALHKEQFTAL 175

Query: 195 IREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFL-YFDVPSITQH 253
           +R++K + RA+ FLLS +VLP+VN T YFD+P++   +D + L  +DFL     P    +
Sbjct: 176 VRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADY 235

Query: 254 LDMITLHAYDFRTPQRNPKEADYSA 278
                  A  +       + A  +A
Sbjct: 236 ------SAPIYHPDGSKDRLAHLNA 254
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 Back     information, alignment and structure
>d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 92 Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 Back     information, alignment and structure
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 Back     information, alignment and structure
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Length = 282 Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Length = 282 Back     information, alignment and structure
>d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 68 Back     information, alignment and structure
>d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 274 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query596
d1jnda1327 Imaginal disc growth factor-2 {Fruit fly (Drosophi 100.0
d1wb0a1297 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 100.0
d2pi6a1292 Signal processing protein (SPC-40, MGP-40) {Sheep 100.0
d1vf8a1302 Chitinase-like lectin ym1, saccharide binding doma 100.0
d1itxa1347 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 100.0
d1edqa2358 Chitinase A, catalytic domain {Serratia marcescens 100.0
d1w9pa1333 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 100.0
d1kfwa1374 Psychrophilic chitinase B {Arthrobacter sp., tad20 100.0
d1ll7a1330 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 100.0
d1goia2356 Chitinase B, catalytic domain {Serratia marcescens 100.0
d1nara_289 Seed storage protein {Vicia narbonensis, Narbonin 99.97
d1edta_265 Endo-beta-N-acetylglucosaminidase {Streptomyces pl 99.94
d2hvma_273 Hevamine A (chitinase/lysozyme) {Para rubber tree 99.93
d2ebna_285 Endo-beta-N-acetylglucosaminidase {Flavobacterium 99.92
d1cnva_283 Seed storage protein {Jack bean (Canavalia ensifor 99.86
d1ta3a_274 Xylanase inhibitor protein I, XIP-I {Wheat (Tritic 99.82
d1eoka_282 Endo-beta-N-acetylglucosaminidase {Flavobacterium 99.62
d1edta_265 Endo-beta-N-acetylglucosaminidase {Streptomyces pl 99.54
d2ebna_285 Endo-beta-N-acetylglucosaminidase {Flavobacterium 99.51
d1jnda292 Imaginal disc growth factor-2 {Fruit fly (Drosophi 99.29
d2pi6a268 Signal processing protein (SPC-40, MGP-40) {Sheep 99.16
d1vf8a270 Chitinase-like lectin ym1 {Mouse (Mus musculus) [T 99.14
d1jnda1327 Imaginal disc growth factor-2 {Fruit fly (Drosophi 99.11
d1wb0a268 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 99.06
d1edqa2358 Chitinase A, catalytic domain {Serratia marcescens 98.97
d1itxa1347 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 98.79
d1kfwa1374 Psychrophilic chitinase B {Arthrobacter sp., tad20 98.71
d1w9pa1333 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 98.64
d1edqa373 Chitinase A {Serratia marcescens [TaxId: 615]} 98.6
d1vf8a1302 Chitinase-like lectin ym1, saccharide binding doma 98.59
d1wb0a1297 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 98.59
d1ll7a1330 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 98.48
d1itxa272 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 98.47
d2pi6a1292 Signal processing protein (SPC-40, MGP-40) {Sheep 98.45
d1goia2356 Chitinase B, catalytic domain {Serratia marcescens 98.35
d1nara_289 Seed storage protein {Vicia narbonensis, Narbonin 98.0
d1kfwa261 Psychrophilic chitinase B {Arthrobacter sp., tad20 97.86
d1ta3a_274 Xylanase inhibitor protein I, XIP-I {Wheat (Tritic 96.86
d1ll7a262 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 96.69
d1w9pa262 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 96.67
d1goia388 Chitinase B {Serratia marcescens [TaxId: 615]} 96.49
d1cnva_283 Seed storage protein {Jack bean (Canavalia ensifor 95.82
d2hvma_273 Hevamine A (chitinase/lysozyme) {Para rubber tree 94.73
d1eoka_282 Endo-beta-N-acetylglucosaminidase {Flavobacterium 93.39
d2aama1285 Hypothetical protein TM1410 {Thermotoga maritima [ 93.12
d2nt0a2354 Glucosylceramidase, catalytic domain {Human (Homo 83.97
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 82.45
d1zy9a2348 Alpha-galactosidase GalA catalytic domain {Thermot 82.31
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Imaginal disc growth factor-2
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=100.00  E-value=3.4e-64  Score=524.68  Aligned_cols=320  Identities=38%  Similarity=0.689  Sum_probs=264.1

Q ss_pred             CceeEeeeeeeecCCCCCCCCCCcCCCCCcccEEEEEEEEecCCCceEEecCCccccccccchhhhHHHHHHHhhhCCCc
Q psy11626         21 DQYHIHSNLYFISSGTAKVGPEELKPALSMCTHLVYGFAGISDSGDYHIKSLDKELDTDKNKGKELFKQITALKTFQPNL  100 (596)
Q Consensus        21 ~~~~~~~~~~~~~~g~~~~~~~~i~~~~~~~Thviyafa~v~~~g~~~~~~~~~~~d~~~~~~~~~~~~~~~lk~~~p~l  100 (596)
                      .++|||++|++||+|.++|.|++|++.+++|||||||||.|+.+ ++.+...+++.|..    +..++++.+||++||++
T Consensus         2 ~ivcYy~~ws~~r~g~~~~~~~~id~~~~~cTHiiyafa~i~~~-~~~~~~~d~~~d~~----~~~~~~~~~lk~~~p~l   76 (327)
T d1jnda1           2 NLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGE-NLQAYSMNENLDIY----KHQFSEVTSLKRKYPHL   76 (327)
T ss_dssp             EEEEEEEGGGGGCSSTTCCCHHHHHHHGGGCSEEEEEEEEECTT-TCCEEETTHHHHTT----TCHHHHHHGGGGTSTTC
T ss_pred             eEEEEECCCcccCCCCCCcCHhhcCCCcccCCeEEEEEEEecCC-CCEEEecCchhhhh----HHHHHHHHHHHHhCCCC
Confidence            36899999999999999999999864478899999999999944 45677777777765    67899999999999999


Q ss_pred             eEEEEEcCCCCCCC---hhhhhhhcCCHHHHHHHHHHHHHHHHHhCCCeeeeeccCCCcCccccccccccchhccccccc
Q psy11626        101 NIMLSVGGFEDDDD---KEKYLEVLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTVT  177 (596)
Q Consensus       101 kvllsiGG~~~~~~---s~~f~~~~~~~~~r~~f~~si~~~l~~~gfDGvdiDwE~p~~~~~~~~~~~~~~~~~~~~~~~  177 (596)
                      |||||||||.....   +..|+.+++++.+|++||++|++||++|||||||||||||+..++..                
T Consensus        77 KvllSiGGw~~~~~~~~~~~~~~~~~~~~rr~~Fi~svv~~l~~~~fDGIDiDWEyP~~~~~~~----------------  140 (327)
T d1jnda1          77 KVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKV----------------  140 (327)
T ss_dssp             EEEEEEETTCCCCTTSTTHHHHHHTCCHHHHHHHHHHHHHHHHHTTCSEEEEECCCCCCCCCCC----------------
T ss_pred             eEEEEEECCCCCCCCcccchhHHHhCCHHHHHHHHHHHHHHHHHCCCCceEEEeeccCCCCccc----------------
Confidence            99999999975321   34577788888888999999999999999999999999998764321                


Q ss_pred             CCCCCCCccchHHHHHHHHHHHHHhhhcCcEEEEEecCCcccccccchhhhhcccceeeeeccccccCCccccccccccc
Q psy11626        178 GPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFLYFDVPSITQHLDMI  257 (596)
Q Consensus       178 g~~~~~~~~d~~~~~~ll~~Lr~~l~~~~~~ls~av~~~~~~~~~~~~~~~~~~~d~i~~m~Yd~~~~~~~~~~~~~d~~  257 (596)
                                ...+....+.+|..+...                                                    
T Consensus       141 ----------~~~~~~~~~~~~~~~~~~----------------------------------------------------  158 (327)
T d1jnda1         141 ----------HGDLGLAWKSIKKLFTGD----------------------------------------------------  158 (327)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ----------ccccchhhhhhhhccccc----------------------------------------------------
Confidence                      111111112222221100                                                    


Q ss_pred             ccccccCCCCCCCCCCCCCCCCcccCCChHHHHHHHHHHHHHHHHhCCCccceeeecCcccCCccccccccceecccccc
Q psy11626        258 TLHAYDFRTPQRNPKEADYSAPLHFLDDPKYRKSFIETTVAALKKYGFNGLDLAWEFPVVTEKHESYTLGSIWHKIKKTV  337 (596)
Q Consensus       258 ~~~~yd~~g~~~~~~~~~~~ap~~~~~~~~~r~~~i~~~i~~~~~~g~dGi~ld~e~p~~~~~~~~~~~~~~~~~~~~~~  337 (596)
                                                                                                      
T Consensus       159 --------------------------------------------------------------------------------  158 (327)
T d1jnda1         159 --------------------------------------------------------------------------------  158 (327)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cCCCCCCCccChHHHHHHHHHHHHHhccCCcEEEEEEcCCcCcccccChhhHhhhccEeEEecccCCCCCCCCCCCCCCC
Q psy11626        338 TGPKDDNPTLHREHFTLLIREMKAAFRAENFLLSASVLPHVNYTVYFDVPSITQHLDMITLHAYDFRTPQRNPKEADYSA  417 (596)
Q Consensus       338 ~g~~~~~~~~d~~~f~~flkelr~~l~~~~~~Ls~av~~~~~~~~~~d~~~i~~~vD~i~vM~YD~~~~~~~~~~~g~~a  417 (596)
                       -...+..+.++++|+.|++|+|++++..+++|++++++.......+|++++.+++||||||+||+|++|+.+..++++|
T Consensus       159 -~~~~~~~~~d~~~~~~l~~elr~~l~~~~~~ls~a~~~~~~~~~~~d~~~l~~~vD~vnlmtYD~~g~~~~~~~~g~~a  237 (327)
T d1jnda1         159 -FIVDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYSA  237 (327)
T ss_dssp             --CCCTTHHHHHHHHHHHHHHHHHHHHTTTCEEEEEECTTCCHHHHCCHHHHHTTCSEEEECCCCSSCTTTCTTCBCCSS
T ss_pred             -cccccccHHHHHHHHHHHHHHHHhhccCCceEEEEecCChHHhhcccHHHHhhhhhhHhhhhhhhcCccccCCcccccC
Confidence             0011223568899999999999999999999999999988777789999999999999999999999999888999999


Q ss_pred             CCCCCCC---CCCCCCHHHHHHHHHHcCCCCCcEEEeeecceeeeeeccCCCCCCCCCcccCCCCCCCCccCCCCcchHH
Q psy11626        418 PLHFVYG---RVPHQNANAMVRWFIEHGVELQKLVLGIPTFGRSWLLEESSHKSGIPPLVADGAGEKGTITKEEGLLSYA  494 (596)
Q Consensus       418 PL~~~~~---~~~~~sv~~~v~~~~~~Gvp~~KLvlGvp~YG~~~~~~~~~~~~g~~~~~~~g~~~~g~~t~~~g~l~Y~  494 (596)
                      ||+....   .....|++.+|++|+++|+|++||+||||                                         
T Consensus       238 pL~~~~~~~~~~~~~~~d~~v~~~~~~G~p~~Kl~lGi~-----------------------------------------  276 (327)
T d1jnda1         238 PIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVA-----------------------------------------  276 (327)
T ss_dssp             CSSCCTTSTTCCTTCSHHHHHHHHHHTTCCGGGEEEEEE-----------------------------------------
T ss_pred             CCCCCCCCCCcccCccHHHHHHHHHHcCCCHHHeEEEEc-----------------------------------------
Confidence            9997652   33457899999999999999999999864                                         


Q ss_pred             HHhhhhccCCccCCCCCCceeccCcccccceeeEecccccccCCCCEEEEeCCHHHHHHHHHHHHHcCCceEEEEeCCCC
Q psy11626        495 EICPQLVSITNAQASPSLLRKQEDPQRRLGTYAFRLADKKLKQEYGTWVSFEEPETAGYKASYAKLAGLGGVAIIDLSLD  574 (596)
Q Consensus       495 ~i~~~~~~~~~~~g~~~~~~~~~D~~~~~~~y~~~~~~~~~~~~~~~~isydd~~Sl~~K~~~a~~~gLgGv~~W~l~~D  574 (596)
                                                                        |||++|++.|++|++++||||||+|+|++|
T Consensus       277 --------------------------------------------------ydd~~Si~~K~~~~~~~~lgGv~~W~l~~D  306 (327)
T d1jnda1         277 --------------------------------------------------TDDPDSASNKAAYARVKNLGGVALFDLSYD  306 (327)
T ss_dssp             --------------------------------------------------SCCHHHHHHHHHHHHHTTCSEEEEECGGGS
T ss_pred             --------------------------------------------------CCCHHHHHHHHHHHHhcCCCEEEEEeccCC
Confidence                                                              689999999999999999999999999999


Q ss_pred             CCCCCCCCCCchHHHHHHhhc
Q psy11626        575 DFRGMCNSNKFPILRAARTQF  595 (596)
Q Consensus       575 D~~g~c~~~~~pLl~ai~~~l  595 (596)
                      ||+|.|++++||||+||+++|
T Consensus       307 Df~G~C~~~~~pLl~ai~~~l  327 (327)
T d1jnda1         307 DFRGQCSGDKYPILRAIKYRL  327 (327)
T ss_dssp             CTTCTTTSCSSHHHHHHHHHC
T ss_pred             CCCCccCCCCChHHHHHHhhC
Confidence            999999889999999999987
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Back     information, alignment and structure
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Back     information, alignment and structure
>d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Back     information, alignment and structure
>d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Back     information, alignment and structure
>d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
>d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Back     information, alignment and structure
>d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1ll7a2 d.26.3.1 (A:293-354) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
>d1w9pa2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1goia3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Back     information, alignment and structure
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Back     information, alignment and structure
>d2aama1 c.1.8.15 (A:28-312) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nt0a2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure