Diaphorina citri psyllid: psy11630


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MTRLGLKPPTSRSKVQRVNHYTTELFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSIIDGTGSIASLSNTLSGDLATVFDIGGIFGGIAAGLISDMTGKSASVCATMLVLSIPMKQKGNQEAEQDYKEHEANPENTIEDKHS
cccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccccccHHEEEEEEEcccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccc
********PTSRSKVQRVNHYTTELFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSIIDGTGSIASLSNTLSGDLATVFDIGGIFGGIAAGLISDMTGKSASVCATMLVLSIPMK***************************
xxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRLGLKPPTSRSKVQRVNHYTTELFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSIIDGTGSIASLSNTLSGDLATVFDIGGIFGGIAAGLISDMTGKSASVCATMLVLSIPMKQKGNQEAEQDYKEHEANPENTIEDKHS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sugar phosphate exchanger 2 confidentQ9WU81
Sugar phosphate exchanger 2 confidentQ5M7K3
Sugar phosphate exchanger 2 confidentQ8TED4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PW4, chain A
Confidence level:confident
Coverage over the Query: 2-91,109-127
View the alignment between query and template
View the model in PyMOL