Psyllid ID: psy11630

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MTRLGLKPPTSRSKVQRVNHYTTELFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSIIDGTGSIASLSNTLSGDLATVFDIGGIFGGIAAGLISDMTGKSASVCATMLVLSIPMKQKGNQEAEQDYKEHEANPENTIEDKHS
ccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccccccHHEEEEEEEcccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccc
cccccccccccccHEEEEcHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHcccHHHHHHHHHHEccccHHHHHHHHHHHHHHccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHcccccHHHHHHccc
mtrlglkpptsrskvqrVNHYTTELFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAelgtheclegnSKALATVTSIIdgtgsiaslsntlsgdlatvfdiGGIFGGIAAGLisdmtgksaSVCATMLVLsipmkqkgnqEAEQDYKeheanpentiedkhs
mtrlglkpptsrskvqrvNHYTTELFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSIIDGTGSIASLSNTLSGDLATVFDIGGIFGGIAAGLISDMTGKSASVCATMLVLSIPMKQKGNQEAEQDYKeheanpentiedkhs
MTRLGLKPPTSRSKVQRVNHYTTELFIYQLLGATsltmsivlllllgslVNGPYALITTAVSAELGTHECLEGNSKALATVTSIIDGTGSIASLSNTLSGDLATVFDiggifggiaagliSDMTGKSASVCATMLVLSIPMKQKGNQEAEQDYKEHEANPENTIEDKHS
****************RVNHYTTELFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSIIDGTGSIASLSNTLSGDLATVFDIGGIFGGIAAGLISDMTGKSASVCATMLVLSI******************************
*******PPTSRSKVQRVNHYTTELFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVS*****************TVTSIIDGTGSIASLSNTLSGDLATVFDIGGIFGGIAAGLISDMTGKSASVCATMLVLSIPMK***************************
****************RVNHYTTELFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSIIDGTGSIASLSNTLSGDLATVFDIGGIFGGIAAGLISDMTGKSASVCATMLVLSIPMK***************************
********PTSRSKVQRVNHYTTELFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSIIDGTGSIASLSNTLSGDLATVFDIGGIFGGIAAGLISDMTGKSASVCATMLVLSIPMKQKGNQEA********************
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRLGLKPPTSRSKVQRVNHYTTELFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSIIDGTGSIASLSNTLSGDLATVFDIGGIFGGIAAGLISDMTGKSASVCATMLVLSIPMKQKGNQEAEQDYKEHEANPENTIEDKHS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query169 2.2.26 [Sep-21-2011]
Q9WU81501 Sugar phosphate exchanger yes N/A 0.449 0.151 0.649 6e-20
Q9SA71510 Putative glycerol-3-phosp yes N/A 0.585 0.194 0.5 8e-20
Q8AVC3499 Sugar phosphate exchanger N/A N/A 0.473 0.160 0.604 1e-19
Q7SY29494 Sugar phosphate exchanger yes N/A 0.408 0.139 0.666 1e-19
Q5M7K3499 Sugar phosphate exchanger yes N/A 0.473 0.160 0.604 1e-19
Q58CV5491 Sugar phosphate exchanger yes N/A 0.668 0.230 0.433 2e-19
Q9C5L3523 Putative glycerol-3-phosp no N/A 0.781 0.252 0.412 6e-19
Q8TED4501 Sugar phosphate exchanger yes N/A 0.449 0.151 0.623 6e-19
O23596544 Putative glycerol-3-phosp no N/A 0.562 0.174 0.519 7e-19
Q9SB41504 Putative glycerol-3-phosp no N/A 0.479 0.160 0.512 2e-17
>sp|Q9WU81|SPX2_MOUSE Sugar phosphate exchanger 2 OS=Mus musculus GN=Slc37a2 PE=2 SV=1 Back     alignment and function desciption
 Score = 96.7 bits (239), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 50/77 (64%), Positives = 64/77 (83%), Gaps = 1/77 (1%)

Query: 25  LFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSI 84
           +F+Y  +G   +T SIV+L++ G LVNGPYALITTAVSA+LGTHE L+GN+KAL+TVT+I
Sbjct: 376 MFLYNYIGQNGITSSIVMLIICGVLVNGPYALITTAVSADLGTHESLKGNAKALSTVTAI 435

Query: 85  IDGTGSI-ASLSNTLSG 100
           IDGTGSI A+L   L+G
Sbjct: 436 IDGTGSIGAALGPLLAG 452

Mus musculus (taxid: 10090)
>sp|Q9SA71|GLPT3_ARATH Putative glycerol-3-phosphate transporter 3 OS=Arabidopsis thaliana GN=At1g30560 PE=3 SV=1 Back     alignment and function description
>sp|Q8AVC3|SPX2_XENLA Sugar phosphate exchanger 2 OS=Xenopus laevis GN=slc37a2 PE=2 SV=1 Back     alignment and function description
>sp|Q7SY29|SPX2_DANRE Sugar phosphate exchanger 2 OS=Danio rerio GN=slc37a2 PE=2 SV=1 Back     alignment and function description
>sp|Q5M7K3|SPX2_XENTR Sugar phosphate exchanger 2 OS=Xenopus tropicalis GN=slc37a2 PE=2 SV=1 Back     alignment and function description
>sp|Q58CV5|SPX2_BOVIN Sugar phosphate exchanger 2 OS=Bos taurus GN=SLC37A2 PE=2 SV=1 Back     alignment and function description
>sp|Q9C5L3|GLPT1_ARATH Putative glycerol-3-phosphate transporter 1 OS=Arabidopsis thaliana GN=At3g47420 PE=2 SV=1 Back     alignment and function description
>sp|Q8TED4|SPX2_HUMAN Sugar phosphate exchanger 2 OS=Homo sapiens GN=SLC37A2 PE=2 SV=2 Back     alignment and function description
>sp|O23596|GLPT4_ARATH Putative glycerol-3-phosphate transporter 4 OS=Arabidopsis thaliana GN=At4g17550 PE=3 SV=2 Back     alignment and function description
>sp|Q9SB41|GLPT2_ARATH Putative glycerol-3-phosphate transporter 2 OS=Arabidopsis thaliana GN=At4g25220 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
189238351 535 PREDICTED: similar to conserved hypothet 0.520 0.164 0.602 6e-20
443731508 464 hypothetical protein CAPTEDRAFT_151589 [ 0.568 0.206 0.491 6e-20
383858894 540 PREDICTED: sugar phosphate exchanger 2-l 0.497 0.155 0.574 1e-19
148693472 527 solute carrier family 37 (glycerol-3-pho 0.449 0.144 0.649 2e-19
193659574 551 PREDICTED: sugar phosphate exchanger 2-l 0.520 0.159 0.606 2e-19
24656861 566 major facilitator superfamily transporte 0.473 0.141 0.641 3e-19
195346375 566 GM15825 [Drosophila sechellia] gi|194135 0.473 0.141 0.641 3e-19
301777247 583 PREDICTED: sugar phosphate exchanger 2-l 0.449 0.130 0.636 4e-19
24656866 528 major facilitator superfamily transporte 0.473 0.151 0.641 5e-19
334330483 702 PREDICTED: sugar phosphate exchanger 2-l 0.449 0.108 0.636 5e-19
>gi|189238351|ref|XP_968141.2| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] gi|270009363|gb|EFA05811.1| hypothetical protein TcasGA2_TC030766 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  102 bits (254), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 53/88 (60%), Positives = 65/88 (73%)

Query: 25  LFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSI 84
           +FIYQ L   SL +++VLL+++G LVNGPYALITTAVSAELGTH  LEGNSKALATVT+I
Sbjct: 413 MFIYQKLSYYSLALNMVLLIVVGILVNGPYALITTAVSAELGTHSSLEGNSKALATVTAI 472

Query: 85  IDGTGSIASLSNTLSGDLATVFDIGGIF 112
           IDGTGSI +    L     + +    +F
Sbjct: 473 IDGTGSIGAAVGPLLAGFVSNYGWSNVF 500

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|443731508|gb|ELU16613.1| hypothetical protein CAPTEDRAFT_151589 [Capitella teleta] Back     alignment and taxonomy information
>gi|383858894|ref|XP_003704934.1| PREDICTED: sugar phosphate exchanger 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|148693472|gb|EDL25419.1| solute carrier family 37 (glycerol-3-phosphate transporter), member 2, isoform CRA_a [Mus musculus] Back     alignment and taxonomy information
>gi|193659574|ref|XP_001950098.1| PREDICTED: sugar phosphate exchanger 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|24656861|ref|NP_726048.1| major facilitator superfamily transporter 16, isoform B [Drosophila melanogaster] gi|21645197|gb|AAM70860.1| major facilitator superfamily transporter 16, isoform B [Drosophila melanogaster] gi|25012481|gb|AAN71345.1| RE26973p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195346375|ref|XP_002039741.1| GM15825 [Drosophila sechellia] gi|194135090|gb|EDW56606.1| GM15825 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|301777247|ref|XP_002924050.1| PREDICTED: sugar phosphate exchanger 2-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|24656866|ref|NP_726049.1| major facilitator superfamily transporter 16, isoform C [Drosophila melanogaster] gi|45550478|ref|NP_611570.3| major facilitator superfamily transporter 16, isoform A [Drosophila melanogaster] gi|15292583|gb|AAK93560.1| SD09370p [Drosophila melanogaster] gi|21645198|gb|AAM70861.1| major facilitator superfamily transporter 16, isoform C [Drosophila melanogaster] gi|45445343|gb|AAF46705.3| major facilitator superfamily transporter 16, isoform A [Drosophila melanogaster] gi|220956242|gb|ACL90664.1| CG10069-PA [synthetic construct] Back     alignment and taxonomy information
>gi|334330483|ref|XP_001371590.2| PREDICTED: sugar phosphate exchanger 2-like [Monodelphis domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
ZFIN|ZDB-GENE-040426-1949494 slc37a2 "solute carrier family 0.449 0.153 0.571 7e-16
MGI|MGI:1929693501 Slc37a2 "solute carrier family 0.449 0.151 0.558 2.5e-15
RGD|1564160501 Slc37a2 "solute carrier family 0.449 0.151 0.558 2.5e-15
TAIR|locus:2028125510 G3Pp3 "AT1G30560" [Arabidopsis 0.479 0.158 0.5 2.6e-15
UNIPROTKB|E1C5M0497 SLC37A2 "Uncharacterized prote 0.449 0.152 0.545 6.7e-15
UNIPROTKB|F1S792497 SLC37A2 "Uncharacterized prote 0.449 0.152 0.545 6.7e-15
UNIPROTKB|Q8TED4501 SLC37A2 "Sugar phosphate excha 0.449 0.151 0.545 8.8e-15
UNIPROTKB|F1Q362497 SLC37A2 "Uncharacterized prote 0.449 0.152 0.545 1.1e-14
UNIPROTKB|F1Q2V8508 SLC37A2 "Uncharacterized prote 0.449 0.149 0.545 1.2e-14
TAIR|locus:2099585523 G3Pp1 "AT3G47420" [Arabidopsis 0.473 0.152 0.518 1.2e-14
ZFIN|ZDB-GENE-040426-1949 slc37a2 "solute carrier family 37 (glycerol-3-phosphate transporter), member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 206 (77.6 bits), Expect = 7.0e-16, P = 7.0e-16
 Identities = 44/77 (57%), Positives = 53/77 (68%)

Query:    25 LFIYQLLGATXXXXXXXXXXXXXXXVNGPYALITTAVSAELGTHECLEGNSKALATVTSI 84
             LF+Y  +G                 VNGPYALITTAVSA+LGTHECL GNS+AL+TVT+I
Sbjct:   369 LFLYNKIGQNGLPTTVGMLLWCGALVNGPYALITTAVSADLGTHECLRGNSRALSTVTAI 428

Query:    85 IDGTGSI-ASLSNTLSG 100
             IDGTGSI A++   L+G
Sbjct:   429 IDGTGSIGAAVGPLLAG 445
GO:0055085 "transmembrane transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0005215 "transporter activity" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0008643 "carbohydrate transport" evidence=IEA
MGI|MGI:1929693 Slc37a2 "solute carrier family 37 (glycerol-3-phosphate transporter), member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1564160 Slc37a2 "solute carrier family 37 (glycerol-3-phosphate transporter), member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2028125 G3Pp3 "AT1G30560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5M0 SLC37A2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S792 SLC37A2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TED4 SLC37A2 "Sugar phosphate exchanger 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q362 SLC37A2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2V8 SLC37A2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TAIR|locus:2099585 G3Pp1 "AT3G47420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9WU81SPX2_MOUSENo assigned EC number0.64930.44970.1516yesN/A
Q7SY29SPX2_DANRENo assigned EC number0.66660.40820.1396yesN/A
Q5M7K3SPX2_XENTRNo assigned EC number0.60490.47330.1603yesN/A
Q8TED4SPX2_HUMANNo assigned EC number0.62330.44970.1516yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
COG2271448 COG2271, UhpC, Sugar phosphate permease [Carbohydr 0.001
TIGR00881379 TIGR00881, 2A0104, phosphoglycerate transporter fa 0.002
>gnl|CDD|225180 COG2271, UhpC, Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information 
 Score = 38.0 bits (89), Expect = 0.001
 Identities = 31/136 (22%), Positives = 49/136 (36%), Gaps = 32/136 (23%)

Query: 25  LFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSI 84
           L +Y L    S  +  +LL ++G L+ GP  LI  A  AE           KA  T T  
Sbjct: 335 LVLYWLAPNGSYLLDAILLFIIGFLIYGPQMLIGLAA-AEFVP-------KKAAGTATGF 386

Query: 85  IDGTGSIASLSNTLSGDLATVFDIGGIFGGIAAGLISDMTGKS--------ASVCATMLV 136
           +     +                IG    G+  G I+D  G          A++ A +L+
Sbjct: 387 VGLFAYL----------------IGAALAGLPLGYIADTWGWDGGFIVLSIAALLAILLL 430

Query: 137 LSIPMKQKGNQEAEQD 152
           L +   ++     E+ 
Sbjct: 431 LPVWNAEERKIRDEKK 446

Length = 448
>gnl|CDD|233167 TIGR00881, 2A0104, phosphoglycerate transporter family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 169
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.77
KOG2533|consensus495 98.94
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 98.59
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 98.45
PRK11663434 regulatory protein UhpC; Provisional 98.39
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 98.1
TIGR00893 399 2A0114 d-galactonate transporter. 98.0
TIGR00881379 2A0104 phosphoglycerate transporter family protein 97.97
PRK11663 434 regulatory protein UhpC; Provisional 97.9
PRK03893496 putative sialic acid transporter; Provisional 97.89
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 97.88
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 97.78
PLN00028476 nitrate transmembrane transporter; Provisional 97.78
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 97.74
PRK15011 393 sugar efflux transporter B; Provisional 97.71
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 97.69
TIGR00880141 2_A_01_02 Multidrug resistance protein. 97.69
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 97.69
TIGR00891405 2A0112 putative sialic acid transporter. 97.68
PRK11902 402 ampG muropeptide transporter; Reviewed 97.68
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 97.67
PRK10489417 enterobactin exporter EntS; Provisional 97.66
PRK10213 394 nepI ribonucleoside transporter; Reviewed 97.64
PRK12307426 putative sialic acid transporter; Provisional 97.62
PRK05122399 major facilitator superfamily transporter; Provisi 97.61
TIGR00891 405 2A0112 putative sialic acid transporter. 97.61
PRK10054 395 putative transporter; Provisional 97.61
TIGR00900 365 2A0121 H+ Antiporter protein. 97.61
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 97.6
PRK03699394 putative transporter; Provisional 97.56
PRK12307 426 putative sialic acid transporter; Provisional 97.56
TIGR00895 398 2A0115 benzoate transport. 97.55
PRK10473 392 multidrug efflux system protein MdtL; Provisional 97.54
PRK10642490 proline/glycine betaine transporter; Provisional 97.52
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 97.5
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 97.5
PRK03545 390 putative arabinose transporter; Provisional 97.47
TIGR00897402 2A0118 polyol permease family. This family of prot 97.41
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 97.38
PRK09874 408 drug efflux system protein MdtG; Provisional 97.37
PRK09669444 putative symporter YagG; Provisional 97.37
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.37
TIGR00898505 2A0119 cation transport protein. 97.36
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 97.36
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 97.35
PRK14995 495 methyl viologen resistance protein SmvA; Provision 97.35
PRK09528420 lacY galactoside permease; Reviewed 97.34
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 97.34
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 97.34
PRK11010 491 ampG muropeptide transporter; Validated 97.33
PRK11652 394 emrD multidrug resistance protein D; Provisional 97.33
PRK09705393 cynX putative cyanate transporter; Provisional 97.31
TIGR00893399 2A0114 d-galactonate transporter. 97.31
PRK10429473 melibiose:sodium symporter; Provisional 97.31
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 97.29
PRK11043 401 putative transporter; Provisional 97.28
PRK09874408 drug efflux system protein MdtG; Provisional 97.27
TIGR00901 356 2A0125 AmpG-related permease. 97.27
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 97.25
PRK10504 471 putative transporter; Provisional 97.23
PRK03893 496 putative sialic acid transporter; Provisional 97.21
PRK15403 413 multidrug efflux system protein MdtM; Provisional 97.2
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 97.18
PRK09848448 glucuronide transporter; Provisional 97.18
PRK03545390 putative arabinose transporter; Provisional 97.17
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 97.16
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 97.13
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 97.12
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 97.12
PRK09952438 shikimate transporter; Provisional 97.09
PRK11646 400 multidrug resistance protein MdtH; Provisional 97.08
TIGR00892455 2A0113 monocarboxylate transporter 1. 97.05
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.03
PRK15075434 citrate-proton symporter; Provisional 97.02
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 97.02
PRK11010491 ampG muropeptide transporter; Validated 97.01
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 96.99
PRK12382392 putative transporter; Provisional 96.99
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 96.99
PRK15011393 sugar efflux transporter B; Provisional 96.98
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 96.97
TIGR00889418 2A0110 nucleoside transporter. This family of prot 96.97
COG2211467 MelB Na+/melibiose symporter and related transport 96.97
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 96.92
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 96.91
COG2807395 CynX Cyanate permease [Inorganic ion transport and 96.91
PRK10077479 xylE D-xylose transporter XylE; Provisional 96.89
PRK09952 438 shikimate transporter; Provisional 96.87
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 96.84
PRK10091 382 MFS transport protein AraJ; Provisional 96.83
PRK10489 417 enterobactin exporter EntS; Provisional 96.82
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 96.8
PRK15075 434 citrate-proton symporter; Provisional 96.79
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 96.79
PRK12382 392 putative transporter; Provisional 96.78
PRK09584 500 tppB putative tripeptide transporter permease; Rev 96.77
KOG0255|consensus 521 96.74
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 96.74
PF13347428 MFS_2: MFS/sugar transport protein 96.74
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 96.74
PRK10504471 putative transporter; Provisional 96.73
PRK05122 399 major facilitator superfamily transporter; Provisi 96.67
PLN00028 476 nitrate transmembrane transporter; Provisional 96.66
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 96.64
TIGR00896355 CynX cyanate transporter. This family of proteins 96.63
TIGR00892 455 2A0113 monocarboxylate transporter 1. 96.62
TIGR00898 505 2A0119 cation transport protein. 96.59
TIGR00900365 2A0121 H+ Antiporter protein. 96.57
PRK11462460 putative transporter; Provisional 96.57
PRK10406432 alpha-ketoglutarate transporter; Provisional 96.53
PRK09528 420 lacY galactoside permease; Reviewed 96.52
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 96.49
PRK10642 490 proline/glycine betaine transporter; Provisional 96.47
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 96.4
PRK03699 394 putative transporter; Provisional 96.37
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 96.33
TIGR00895398 2A0115 benzoate transport. 96.25
PRK03633381 putative MFS family transporter protein; Provision 96.24
PRK10406 432 alpha-ketoglutarate transporter; Provisional 96.22
PRK11043401 putative transporter; Provisional 96.22
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 96.13
TIGR01272310 gluP glucose/galactose transporter. Disruption of 96.11
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 96.1
TIGR00896 355 CynX cyanate transporter. This family of proteins 95.97
PRK03633 381 putative MFS family transporter protein; Provision 95.92
KOG2533|consensus 495 95.91
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 95.89
PRK10133438 L-fucose transporter; Provisional 95.89
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 95.87
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 95.84
TIGR00788 468 fbt folate/biopterin transporter. The only functio 95.79
PRK10091382 MFS transport protein AraJ; Provisional 95.76
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 95.75
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 95.7
TIGR00897 402 2A0118 polyol permease family. This family of prot 95.7
PRK10054395 putative transporter; Provisional 95.64
PRK09705 393 cynX putative cyanate transporter; Provisional 95.51
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 95.47
PRK11195 393 lysophospholipid transporter LplT; Provisional 95.45
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 95.32
PRK15462 493 dipeptide/tripeptide permease D; Provisional 95.22
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 95.19
PRK10473392 multidrug efflux system protein MdtL; Provisional 95.16
PRK11902402 ampG muropeptide transporter; Reviewed 95.1
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 95.09
PRK10077 479 xylE D-xylose transporter XylE; Provisional 95.07
PRK10207 489 dipeptide/tripeptide permease B; Provisional 94.99
PRK15402406 multidrug efflux system translocase MdfA; Provisio 94.99
PRK11646400 multidrug resistance protein MdtH; Provisional 94.98
PRK11462 460 putative transporter; Provisional 94.95
PRK11652394 emrD multidrug resistance protein D; Provisional 94.91
PRK10133 438 L-fucose transporter; Provisional 94.75
KOG2504|consensus509 94.74
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 94.65
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 94.34
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 94.34
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 94.28
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 94.17
PRK11195393 lysophospholipid transporter LplT; Provisional 94.15
PRK10429 473 melibiose:sodium symporter; Provisional 94.08
PRK09669 444 putative symporter YagG; Provisional 93.91
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 93.7
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 93.53
PRK14995495 methyl viologen resistance protein SmvA; Provision 93.36
KOG0569|consensus485 93.19
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 92.8
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 92.77
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 92.44
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 92.35
KOG2615|consensus 451 92.28
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 92.12
PF13347 428 MFS_2: MFS/sugar transport protein 91.96
TIGR00902382 2A0127 phenyl proprionate permease family protein. 91.94
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 91.88
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 91.85
PRK10213394 nepI ribonucleoside transporter; Reviewed 91.35
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 90.98
PTZ00207 591 hypothetical protein; Provisional 90.5
TIGR00805 633 oat sodium-independent organic anion transporter. 90.22
COG0738422 FucP Fucose permease [Carbohydrate transport and m 89.71
COG2270438 Permeases of the major facilitator superfamily [Ge 89.64
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 89.24
COG2211 467 MelB Na+/melibiose symporter and related transport 87.99
PF07672267 MFS_Mycoplasma: Mycoplasma MFS transporter; InterP 87.55
KOG0253|consensus528 87.51
KOG2504|consensus 509 87.08
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 85.02
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 84.48
PRK15403413 multidrug efflux system protein MdtM; Provisional 84.27
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 83.31
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 83.06
KOG2532|consensus 466 80.07
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=99.77  E-value=3.2e-19  Score=162.94  Aligned_cols=96  Identities=29%  Similarity=0.424  Sum_probs=90.9

Q ss_pred             CCCCCCCcchHHHHHHHHHHHHHHHhhcCCcHHHHHHHHHHHhhhhcchHHHHHHHHhhhccccccccCCcchhhhhhhh
Q psy11630          5 GLKPPTSRSKVQRVNHYTTELFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSI   84 (169)
Q Consensus         5 g~~~~~~~~~v~~l~~~~~~l~~y~~~~~~~~~~~~~ll~l~Gffi~GP~~Li~~a~a~dlg~~~~l~~n~kA~atvtgi   84 (169)
                      |||.|+   +++++++.+.++..||+.+.+++.+..++++.+|||+||||+|+ +.+++|+++       |||+||++|+
T Consensus       318 grR~p~---~~i~~~~i~~~~~~~w~~~~~~~~l~~~~l~~iGf~IyGPqmLi-Gl~a~e~~p-------K~AaGtA~Gf  386 (448)
T COG2271         318 GRRGPM---ALIFMLLITASLVLYWLAPNGSYLLDAILLFIIGFLIYGPQMLI-GLAAAEFVP-------KKAAGTATGF  386 (448)
T ss_pred             cccchH---HHHHHHHHHHHHHHHHcCCCccHHHHHHHHHHHHHHHhhHHHHH-HHHHhcccc-------Hhhccchhch
Confidence            899999   99999999999999999988899999999999999999999888 589999998       4799999999


Q ss_pred             hcccccccccCccccCCcchhhccchhhhhhHHHHhhhccCCc
Q psy11630         85 IDGTGSIASLSNTLSGDLATVFDIGGIFGGIAAGLISDMTGKS  127 (169)
Q Consensus        85 Idg~Gsi~~~~~~~a~~LS~~~DvGaaiggiliG~Isd~~GW~  127 (169)
                      ++.++|+                +|+++++++.|+++|.+||.
T Consensus       387 ~Glf~Yl----------------~Ga~~a~~~~g~i~d~~gW~  413 (448)
T COG2271         387 VGLFAYL----------------IGAALAGLPLGYIADTWGWD  413 (448)
T ss_pred             hhhHHHH----------------hhHHhcCCcceeeEecCCCc
Confidence            9999998                37888999999999999999

>KOG2533|consensus Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07672 MFS_Mycoplasma: Mycoplasma MFS transporter; InterPro: IPR011699 These proteins share some similarity with members of the Major Facilitator Superfamily (MFS) Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 7e-13
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 1e-05
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Length = 451 Back     alignment and structure
 Score = 64.3 bits (157), Expect = 7e-13
 Identities = 21/137 (15%), Positives = 47/137 (34%), Gaps = 33/137 (24%)

Query: 25  LFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSI 84
             +Y +  A + T+ ++ ++++G L+ GP  LI        G H       KA  T    
Sbjct: 335 TIVYWMNPAGNPTVDMICMIVIGFLIYGPVMLI--------GLHALELAPKKAAGTAAGF 386

Query: 85  IDGTGSIASLSNTLSGDLATVFDIGGIFGGIAAGLISDMTGK---------SASVCATML 135
               G +                 G +      G   D  G           + +   +L
Sbjct: 387 TGLFGYLG----------------GSVAASAIVGYTVDFFGWDGGFMVMIGGSILAVILL 430

Query: 136 VLSIPMKQKGNQEAEQD 152
           ++ +  +++ +++  Q+
Sbjct: 431 IVVMIGEKRRHEQLLQE 447
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Length = 451 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 98.24
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 97.85
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 97.75
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 97.5
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 97.42
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 97.27
2xut_A 524 Proton/peptide symporter family protein; transport 97.12
2xut_A524 Proton/peptide symporter family protein; transport 97.04
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 97.0
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 95.99
2cfq_A417 Lactose permease; transport, transport mechanism, 95.61
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 93.31
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 91.22
2cfq_A 417 Lactose permease; transport, transport mechanism, 91.1
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
Probab=98.24  E-value=2e-06  Score=70.27  Aligned_cols=81  Identities=23%  Similarity=0.347  Sum_probs=60.7

Q ss_pred             HHHHHHHhhcCCcHHHHHHHHHHHhhhhcchHHHHHHHHhhhccccccccCCcchhhhhhhhhcccccccccCccccCCc
Q psy11630         23 TELFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATVTSIIDGTGSIASLSNTLSGDL  102 (169)
Q Consensus        23 ~~l~~y~~~~~~~~~~~~~ll~l~Gffi~GP~~Li~~a~a~dlg~~~~l~~n~kA~atvtgiIdg~Gsi~~~~~~~a~~L  102 (169)
                      ..++.+.+.+..+.+...+.+++.|++..++..... +...|..++       +..+++.|+.+..+++           
T Consensus       333 ~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~-~~~~~~~~~-------~~~g~~~~~~~~~~~~-----------  393 (451)
T 1pw4_A          333 IATIVYWMNPAGNPTVDMICMIVIGFLIYGPVMLIG-LHALELAPK-------KAAGTAAGFTGLFGYL-----------  393 (451)
T ss_dssp             HHHHHTTSCCTTCHHHHHHHHHHHHHHHTHHHHHHH-HHHHHTSCT-------THHHHHHHHHHHHHHH-----------
T ss_pred             HHHHHHHHhcccCHHHHHHHHHHHHHHHhchHHHHH-HHHHHHhch-------hhhhhHHHHHHHHHHH-----------
Confidence            444444443434677777778899999998887764 566777653       5788999998877765           


Q ss_pred             chhhccchhhhhhHHHHhhhccCCc
Q psy11630        103 ATVFDIGGIFGGIAAGLISDMTGKS  127 (169)
Q Consensus       103 S~~~DvGaaiggiliG~Isd~~GW~  127 (169)
                           +|+++++.+.|++.|.+||+
T Consensus       394 -----~g~~~~~~~~g~l~~~~g~~  413 (451)
T 1pw4_A          394 -----GGSVAASAIVGYTVDFFGWD  413 (451)
T ss_dssp             -----HHHHHHHHHHHHHHHSSCSH
T ss_pred             -----HHHHHHHHHHHHHHHhcCcH
Confidence                 27788999999999999998
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 98.86
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 97.92
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 97.45
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 96.02
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]

Probab=98.86  E-value=2.2e-09  Score=84.64  Aligned_cols=100  Identities=22%  Similarity=0.273  Sum_probs=73.0

Q ss_pred             CcCCCCCCCCcchHHHHHHHHHHHHHHHhhcCCcHHHHHHHHHHHhhhhcchHHHHHHHHhhhccccccccCCcchhhhh
Q psy11630          2 TRLGLKPPTSRSKVQRVNHYTTELFIYQLLGATSLTMSIVLLLLLGSLVNGPYALITTAVSAELGTHECLEGNSKALATV   81 (169)
Q Consensus         2 ~~~g~~~~~~~~~v~~l~~~~~~l~~y~~~~~~~~~~~~~ll~l~Gffi~GP~~Li~~a~a~dlg~~~~l~~n~kA~atv   81 (169)
                      ||.+|+.+. +..+..+......++.+......+.+...++++++|+...++..+.. +...|..+       ++..|++
T Consensus       310 ~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~-~~~~~~~p-------~~~~g~~  380 (447)
T d1pw4a_         310 DKVFRGNRG-ATGVFFMTLVTIATIVYWMNPAGNPTVDMICMIVIGFLIYGPVMLIG-LHALELAP-------KKAAGTA  380 (447)
T ss_dssp             HHTSTTCHH-HHHHHHHHHHHHHHHHTTSCCTTCHHHHHHHHHHHHHHHTHHHHHHH-HHHHHTSC-------TTHHHHH
T ss_pred             hhccccccc-cccchhHHHHHHHHHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHcC-------HHHHHHH
Confidence            466666543 11233334444455555555566777788888899999999988875 56778766       3588999


Q ss_pred             hhhhcccccccccCccccCCcchhhccchh-hhhhHHHHhhhccCCc
Q psy11630         82 TSIIDGTGSIASLSNTLSGDLATVFDIGGI-FGGIAAGLISDMTGKS  127 (169)
Q Consensus        82 tgiIdg~Gsi~~~~~~~a~~LS~~~DvGaa-iggiliG~Isd~~GW~  127 (169)
                      .|+++.++++                 ++. +++++.|++.|.+||+
T Consensus       381 ~g~~~~~~~~-----------------~g~~~~~~~~g~~~~~~g~~  410 (447)
T d1pw4a_         381 AGFTGLFGYL-----------------GGSVAASAIVGYTVDFFGWD  410 (447)
T ss_dssp             HHHHHHHHHH-----------------HHHHHHHHHHHHHHHSSCSH
T ss_pred             HHHHHHHHHH-----------------HHHHHHHHHHHHHHHHhChH
Confidence            9999999998                 654 5788999999999998
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure