Diaphorina citri psyllid: psy11640

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550--

MGFRDVISGCKKKKKKKKKKKKKKKKKKKKKKKKRPSAGKSLVGVTACCTVRKRALVLCNSGVSVEQWKHQFKLWSTADDSMICRFTSEAKDKPMGCGILVTTYSMISHTQKRSWEADQTMQWLQNQEWGIMLLDDGVPVAAKKNVEKDDAAVPEDEFGAKDYRAQMVLKPDHKSRPLWVAPNGHIFLESFSPVYRHAHDFLIAIAEPVCRPEHIHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKRGFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLINQGYSYKVITKLAGMEEERGMHYSTRDEQGQLLQQVLAASETDADEERVAGEVGGVSGGFKRSGGTMASLSGADDAVYHESRFSNVKHPLFKKFRG

ccccHHHcccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHccccccccEEEccccccccccccEEEEcccEEEccccccHHHHHHHHHHHcccccEEEEcccccHHHHHcccccccccccccccHHHHHHHHHcccccccccCEECccccEEEECccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccEEcccHHHHHHcccccEEEEEEEECcccHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHcccCEEEEcccHHHHHHHHHHHccccEEccccHHHHHHHHHHHHccccEEEEEEEcccccccccccccEEEEEccccccHHHHHHHHHcccccccccccccEEEEEEEEEEccccccHHHHHHHHHHHHcccEEEEEEEccccccccccccccHHHHHHHHHHHHHccccHHHHHHcccccccccccEEEccccccccccccccEEEEEcccccccccHHcccc

**FRD***********************************SLVGVTACCTVRKRALVLCNSGVSVEQWKHQFKLWSTADDSMICRFTSEAKDKPMGCGILVTTYSMISHTQKRSWEADQTMQWLQNQEWGIMLLDDGVPVAAKKNVEKDDAAVPEDEFGAKDYRAQMVLKPDHKSRPLWVAPNGHIFLESFSPVYRHAHDFLIAIAEPVCRPEHIHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKRGFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEANVLIQISSHG*********LGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLINQGYSYKVITKLAGMEEERGMHYSTRDEQGQLLQQVLA***************************************************LFKKFRG

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGFRDVISGxxxxxxxxxxxxxxxxxxxxxxxxxxPSAGKSLVGVTACCTVRKRALVLCNSGVSVEQWKHQFKLWSTADDSMICRFTSEAKDKPMGCGILVTTYSMISHTQKRSWEADQTMQWLQNQEWGIMLLDDGVPVAAKKNVEKDDAAVPEDEFGAKDYRAQMVLKPDHKSRPLWVAPNGHIFLESFSPVYRHAHDFLIAIAEPVCRPEHIHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKRGFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLINQGYSYKVITKLAGMEEERGMHYSTRDEQGQLLQQVLAASETDADEERVAGEVGGVSGGFKRSGGTMASLSGADDAVYHESRFSNVKHPLFKKFRG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
TFIIH basal transcription factor complex helicase XPB subunit	ATP-dependent 3'-5' DNA helicase, component of the core-TFIIH basal transcription factor, involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Acts by opening DNA either around the RNA transcription start site or the DNA damage.	confident	Q1RMT1
TFIIH basal transcription factor complex helicase XPB subunit	ATP-dependent 3'-5' DNA helicase, component of the core-TFIIH basal transcription factor, involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Acts by opening DNA either around the RNA transcription start site or the DNA damage.	confident	Q5ZKK7
TFIIH basal transcription factor complex helicase XPB subunit	ATP-dependent 3'-5' DNA helicase, component of the core-TFIIH basal transcription factor, involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Acts by opening DNA either around the RNA transcription start site or the DNA damage.	confident	Q7ZVV1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0033683 [BP]	nucleotide-excision repair, DNA incision	probable	GO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006289, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0008353 [MF]	RNA polymerase II carboxy-terminal domain kinase activity	probable	GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0006200 [BP]	ATP catabolic process	probable	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0032564 [MF]	dATP binding	probable	GO:0043168, GO:0030554, GO:0000166, GO:0097159, GO:0043167, GO:0036094, GO:0003674, GO:0032558, GO:0017076, GO:0032554, GO:0032552, GO:1901363, GO:1901265, GO:0005488
GO:0008134 [MF]	transcription factor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0004003 [MF]	ATP-dependent DNA helicase activity	probable	GO:0008094, GO:0016818, GO:0008026, GO:0042623, GO:0016787, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003674, GO:0016887, GO:0003678, GO:0016462, GO:0003824
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005525 [MF]	GTP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0042277 [MF]	peptide binding	probable	GO:0033218, GO:0003674, GO:0005488
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0006283 [BP]	transcription-coupled nucleotide-excision repair	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006289, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0006370 [BP]	7-methylguanosine mRNA capping	probable	GO:0036260, GO:0009452, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0044238, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0008022 [MF]	protein C-terminus binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0050434 [BP]	positive regulation of viral transcription	probable	GO:0009893, GO:0019222, GO:0031328, GO:2000243, GO:0031325, GO:2000241, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:0019219, GO:0065007, GO:0046782, GO:0031326, GO:0048518, GO:0045935, GO:0060255, GO:0050792, GO:0009889, GO:0050794, GO:0043902, GO:0043900, GO:0008150, GO:0051171, GO:2001141, GO:0051173, GO:0051252, GO:0051254, GO:0010557, GO:0010556, GO:0048524, GO:0048522
GO:0006979 [BP]	response to oxidative stress	probable	GO:0006950, GO:0008150, GO:0050896
GO:0047485 [MF]	protein N-terminus binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0008104 [BP]	protein localization	probable	GO:0033036, GO:0008150, GO:0051179
GO:0000718 [BP]	nucleotide-excision repair, DNA damage removal	probable	GO:0044238, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0044349, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0006308, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0051716, GO:0046700, GO:0006974, GO:0006259, GO:0006950, GO:0008150, GO:0008152, GO:0034655, GO:0006289, GO:0009056, GO:0009057, GO:0046483, GO:0044248, GO:0044270, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0019439, GO:0044763
GO:0000717 [BP]	nucleotide-excision repair, DNA duplex unwinding	probable	GO:0071103, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0032392, GO:0006281, GO:0032508, GO:0009987, GO:0006725, GO:0006289, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0009650 [BP]	UV protection	probable	GO:0009628, GO:0009314, GO:0050896, GO:0009411, GO:0008150, GO:0009416
GO:0006361 [BP]	transcription initiation from RNA polymerase I promoter	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006360, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0006363 [BP]	termination of RNA polymerase I transcription	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006360, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006353, GO:0019438
GO:0006362 [BP]	transcription elongation from RNA polymerase I promoter	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006360, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006354, GO:0006351, GO:0019438
GO:0006367 [BP]	transcription initiation from RNA polymerase II promoter	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0006368 [BP]	transcription elongation from RNA polymerase II promoter	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006354, GO:0006351, GO:0019438
GO:0000112 [CC]	nucleotide-excision repair factor 3 complex	probable	GO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0000109, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0008344 [BP]	adult locomotory behavior	probable	GO:0007626, GO:0032501, GO:0044707, GO:0030534, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0044699
GO:0005675 [CC]	holo TFIIH complex	probable	GO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0003677 [MF]	DNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0006917 [BP]	induction of apoptosis	probable	GO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0000075 [BP]	cell cycle checkpoint	probable	GO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:1901987, GO:0010948, GO:0065007, GO:1901988, GO:0048519, GO:0050789, GO:0048523
GO:0006265 [BP]	DNA topological change	probable	GO:0071103, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0043138 [MF]	3'-5' DNA helicase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674, GO:0003678, GO:0004386
GO:0035315 [BP]	hair cell differentiation	probable	GO:0030154, GO:0008544, GO:0007275, GO:0044699, GO:0048869, GO:0048513, GO:0030855, GO:0032502, GO:0032501, GO:0030182, GO:0060429, GO:0009888, GO:0008150, GO:0048731, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0009913, GO:0048856, GO:0044763, GO:0009987
GO:0000381 [BP]	regulation of alternative mRNA splicing, via spliceosome	probable	GO:0051252, GO:0080090, GO:0019222, GO:0060255, GO:0050684, GO:0043484, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0048024, GO:0008150, GO:0010468
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0070816 [BP]	phosphorylation of RNA polymerase II C-terminal domain	probable	GO:0080090, GO:0019222, GO:0016310, GO:0031323, GO:0050789, GO:0044267, GO:0044260, GO:0071704, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0031326, GO:0010468, GO:0006468, GO:0019219, GO:0009987, GO:0009889, GO:0006464, GO:0050794, GO:0043412, GO:0036211, GO:0008150, GO:0051171, GO:0008152, GO:2001141, GO:0044238, GO:0019538, GO:0051252, GO:0044237, GO:0043170, GO:0006355, GO:0006796, GO:0010556, GO:0006793
GO:0001666 [BP]	response to hypoxia	probable	GO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0000439 [CC]	core TFIIH complex	probable	GO:0043234, GO:0032806, GO:0032991, GO:0005575, GO:0005634, GO:0044464, GO:0005623, GO:0043231, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0000441
GO:0016032 [BP]	viral reproduction	probable	GO:0009987, GO:0044764, GO:0008150, GO:0051704

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.6.-.-	Acting on acid anhydrides.	probable
3.6.4.-	Acting on acid anhydrides; involved in cellular and subcellular movement.	probable
3.6.4.12	DNA helicase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FWR, chain A
Confidence level:very confident
Coverage over the Query: 28-110,121-139,221-443
View the alignment between query and template
View the model in PyMOL

Template: 4ERN, chain A
Confidence level:very confident
Coverage over the Query: 277-506
View the alignment between query and template
View the model in PyMOL

Template: 1Z63, chain A
Confidence level:confident
Coverage over the Query: 6-110,121-142,222-449
View the alignment between query and template
View the model in PyMOL