Psyllid ID: psy11640

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550--
MGFRDVISGCKKKKKKKKKKKKKKKKKKKKKKKKRPSAGKSLVGVTACCTVRKRALVLCNSGVSVEQWKHQFKLWSTADDSMICRFTSEAKDKPMGCGILVTTYSMISHTQKRSWEADQTMQWLQNQEWGIMLLDDGVPVAAKKNVEKDDAAVPEDEFGAKDYRAQMVLKPDHKSRPLWVAPNGHIFLESFSPVYRHAHDFLIAIAEPVCRPEHIHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKRGFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLINQGYSYKVITKLAGMEEERGMHYSTRDEQGQLLQQVLAASETDADEERVAGEVGGVSGGFKRSGGTMASLSGADDAVYHESRFSNVKHPLFKKFRG
cccHHHHcccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHccccccccEEEccccccccccccEEEEcccEEEccccccHHHHHHHHHHHcccccEEEEcccccHHHHHcccccccccccccccHHHHHHHHHcccccccccEEEEccccEEEEEccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccEEcccHHHHHHcccccEEEEEEEEEcccHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHccccEEccccHHHHHHHHHHHHHcccEEEEEEEcccccccccccccEEEEEccccccHHHHHHHHHcccccccccccccEEEEEEEEEEccccccHHHHHHHHHHHHcccEEEEEEEccccccccccccccHHHHHHHHHHHHHccccHHHHHHHccccccccccEEEccccccccccccccEEEEEcccccccccHHcccc
ccccHHEcccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHccccHHHHEEEccccccccccccEEEEEEEEEcccccccHHHHHHHHHHccccEEEEEEccEEEEEcEEEEEEEEEEEEccHcHHHHHHHHHHccccccccccEEcccccEEEEccHHHHHHHHHHHHHHHccccccEEEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHccccHccccHHHHHHcccEEEEEEEEEEccccHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHcccEEEccccHHHHHHHHHHHcccccEcEEEEEEEccccccccccEEEEEEEcccccHHHHHHHHHHHEccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccHHHHHHHHHHHHHccHHHccHHccccccccccccEEEccccHHHHccccccEEEEEccccccccHHHHccc
mgfrdvisGCKKKKKKKKKKKKKKKKKKkkkkkkrpsagkslvgvtACCTVRKRALVLCNSGVSVEQWKHQFKLWStaddsmicrftseakdkpmgcgiLVTTYSMISHTQKRSWEADQTMQWLQNQEWGimllddgvpvaakknvekddaavpedefgakdyraqmvlkpdhksrplwvapnghiflesfspvyrHAHDFLIAiaepvcrpehihevhtipAKMFRRVLTIVQSHCKLGltatllreddkiadlnfligpKLYEANWLELQKRGFIARVQCaevwcpmspefYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYherrgdktivfsDNVFALKHYAvkmnkpyiygptsqSERIQILQnfklnpkvnTIFVSKvadtsfdlpeANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLINQGYSYKVITKLAgmeeergmhystrDEQGQLLQQVLAASetdadeervagevggvsggfkrsggtmaslsgaddavyhesrfsnvkhplfkkfrg
mgfrdvisgckkkkkkkkkkkkkkkkkkkkkkkkrpsagkslvgvtaccTVRKRALVLCNSGVSVEQWKHQFKLWSTADDSMICRFTseakdkpmgcGILVTTYSMISHTQKRSWEADQTMQWLQNQEWGIMLLDDGVPVAAKKnvekddaavpedefgakDYRAQMVLKPDHKSRPLWVAPNGHIFLESFSPVYRHAHDFLIAIAEPVCRPEHIHEVHTIPAKMFRRVLTIVQSHCKLGLtatllreddkIADLNFLIGPKLYEANWLELQKRGFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEANVLIQisshggsrrqEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQrflinqgysyKVITKLAGMEEERGMHYSTRDEQGQLLQQVLAASetdadeervagevggvsggfkrsgGTMASLSGADDAVYHesrfsnvkhplfkkfrg
MGFRDVISGCkkkkkkkkkkkkkkkkkkkkkkkkRPSAGKSLVGVTACCTVRKRALVLCNSGVSVEQWKHQFKLWSTADDSMICRFTSEAKDKPMGCGILVTTYSMISHTQKRSWEADQTMQWLQNQEWGIMLLDDGVPVAAKKNVEKDDAAVPEDEFGAKDYRAQMVLKPDHKSRPLWVAPNGHIFLESFSPVYRHAHDFLIAIAEPVCRPEHIHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKRGFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLINQGYSYKVITKLAGMEEERGMHYSTRDEQGQLLQQVLAASETDADEERVAGEvggvsggfkrsggTMASLSGADDAVYHESRFSNVKHPLFKKFRG
*****************************************LVGVTACCTVRKRALVLCNSGVSVEQWKHQFKLWSTADDSMICRFTSEAKDKPMGCGILVTTYSMISHTQKRSWEADQTMQWLQNQEWGIMLLDDGVPVAA***********************QMVL****KSRPLWVAPNGHIFLESFSPVYRHAHDFLIAIAEPVCRPEHIHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKRGFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEANVLIQIS************LGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLINQGYSYKVITKLAG**********************************************************************************
**FRD***********************************SLVGVTACCTVRKRALVLCNSGVSVEQWKHQFKLWSTADDSMICRFTSEAKDKPMGCGILVTTYSMISHTQKRSWEADQTMQWLQNQEWGIMLLDDGVPVAAKKNVEKDDAAVPEDEFGAKDYRAQMVLKPDHKSRPLWVAPNGHIFLESFSPVYRHAHDFLIAIAEPVCRPEHIHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKRGFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEANVLIQISSHG********************IAEEYNAFFYTLVSQDTMEMSYSRKRQRFLINQGYSYKVITKLAGMEEERGMHYSTRDEQGQLLQQVLA***************************************************LFKKFRG
MGFRDVIS**********************************VGVTACCTVRKRALVLCNSGVSVEQWKHQFKLWSTADDSMICRFTSEAKDKPMGCGILVTTYSMISHTQKRSWEADQTMQWLQNQEWGIMLLDDGVPVAAKKNVEKDDAAVPEDEFGAKDYRAQMVLKPDHKSRPLWVAPNGHIFLESFSPVYRHAHDFLIAIAEPVCRPEHIHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKRGFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEANVLIQIS***********RLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLINQGYSYKVITKLAGMEEERGMHYSTRDEQGQLLQQVLAASETDADEERVAGEVGGVSGGFKRSGGTMASLSGADDAVYHESRFSNVKHPLFKKFRG
*GFRDVISGCKKKKKKKKKKKKKKKKKKKKKKK***SAGKSLVGVTACCTVRKRALVLCNSGVSVEQWKHQFKLWSTADDSMICRFTSEAKDKPMGCGILVTTYSMISHTQKRSWEADQTMQWLQNQEWGIMLLDDGVPVAAKKNVEKDDAAVPEDEFGAKDYRAQMVLKPDHKSRPLWVAPNGHIFLESFSPVYRHAHDFLIAIAEPVCRPEHIHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKRGFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLINQGYSYKVITKLAGMEEERGMHYSTRDEQGQLLQQVLAASET***************GGFKRSGGTMASLSGADDAVYHESRFSNVKHP*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFRDVISGxxxxxxxxxxxxxxxxxxxxxxxxxxPSAGKSLVGVTACCTVRKRALVLCNSGVSVEQWKHQFKLWSTADDSMICRFTSEAKDKPMGCGILVTTYSMISHTQKRSWEADQTMQWLQNQEWGIMLLDDGVPVAAKKNVEKDDAAVPEDEFGAKDYRAQMVLKPDHKSRPLWVAPNGHIFLESFSPVYRHAHDFLIAIAEPVCRPEHIHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKRGFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLINQGYSYKVITKLAGMEEERGMHYSTRDEQGQLLQQVLAASETDADEERVAGEVGGVSGGFKRSGGTMASLSGADDAVYHESRFSNVKHPLFKKFRG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query552 2.2.26 [Sep-21-2011]
Q02870798 DNA excision repair prote yes N/A 0.610 0.422 0.802 1e-163
Q4G005782 TFIIH basal transcription yes N/A 0.608 0.429 0.763 1e-156
P49135783 TFIIH basal transcription yes N/A 0.608 0.429 0.760 1e-156
Q7ZVV1782 TFIIH basal transcription yes N/A 0.605 0.427 0.760 1e-156
Q1RMT1782 TFIIH basal transcription yes N/A 0.608 0.429 0.758 1e-155
Q5RA62782 TFIIH basal transcription yes N/A 0.608 0.429 0.758 1e-155
P19447782 TFIIH basal transcription yes N/A 0.608 0.429 0.758 1e-155
Q60HG1782 TFIIH basal transcription N/A N/A 0.608 0.429 0.758 1e-155
Q5ZKK7788 TFIIH basal transcription yes N/A 0.601 0.421 0.744 1e-146
Q00578843 DNA repair helicase RAD25 yes N/A 0.606 0.397 0.589 1e-114
>sp|Q02870|ERCC3_DROME DNA excision repair protein haywire OS=Drosophila melanogaster GN=hay PE=1 SV=2 Back     alignment and function desciption
 Score =  576 bits (1485), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 276/344 (80%), Positives = 308/344 (89%), Gaps = 7/344 (2%)

Query: 215 IHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKR 274
           + EVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQK+
Sbjct: 456 LDEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKK 515

Query: 275 GFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTI 334
           G+IARVQCAEVWCPMSPEFYREYL  KTSK++LLYVMNP+K+R+ Q+LI YHE+RGDKTI
Sbjct: 516 GYIARVQCAEVWCPMSPEFYREYLTTKTSKKMLLYVMNPSKFRSCQFLIKYHEQRGDKTI 575

Query: 335 VFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPE 394
           VFSDNVFALKHYA+KMNKP+IYGPTSQ+ERIQILQNFK N KVNTIFVSKVADTSFDLPE
Sbjct: 576 VFSDNVFALKHYAIKMNKPFIYGPTSQNERIQILQNFKFNSKVNTIFVSKVADTSFDLPE 635

Query: 395 ANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRF 454
           ANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRF
Sbjct: 636 ANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRF 695

Query: 455 LINQGYSYKVITKLAGMEEERGMHYSTRDEQGQLLQQVLAASETDADEERVAGEVG---- 510
           L+NQGYSYKVIT L GM+ +  + Y T++EQGQLLQ VL+AS+ D ++E++ GE G    
Sbjct: 696 LVNQGYSYKVITHLKGMDTDSDLMYGTQEEQGQLLQLVLSASDLDCEDEKLPGEPGYRPS 755

Query: 511 GVSGGFKRSGGTMASLSGADDAVYHESRFSNVK--HPLFKKFRG 552
           G  G  +R GG ++S+SG DDA+Y+E R  N+   HPLFKKFRG
Sbjct: 756 GSGGAVRRVGG-LSSMSGGDDAIYYEHRKKNIGSVHPLFKKFRG 798
Probably an ATP-dependent DNA helicase involved in excision repair of DNA. May have a DNA unwinding function.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q4G005|ERCC3_RAT TFIIH basal transcription factor complex helicase XPB subunit OS=Rattus norvegicus GN=Ercc3 PE=2 SV=1 Back     alignment and function description
>sp|P49135|ERCC3_MOUSE TFIIH basal transcription factor complex helicase XPB subunit OS=Mus musculus GN=Ercc3 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZVV1|ERCC3_DANRE TFIIH basal transcription factor complex helicase XPB subunit OS=Danio rerio GN=ercc3 PE=2 SV=1 Back     alignment and function description
>sp|Q1RMT1|ERCC3_BOVIN TFIIH basal transcription factor complex helicase XPB subunit OS=Bos taurus GN=ERCC3 PE=2 SV=1 Back     alignment and function description
>sp|Q5RA62|ERCC3_PONAB TFIIH basal transcription factor complex helicase XPB subunit OS=Pongo abelii GN=ERCC3 PE=2 SV=1 Back     alignment and function description
>sp|P19447|ERCC3_HUMAN TFIIH basal transcription factor complex helicase XPB subunit OS=Homo sapiens GN=ERCC3 PE=1 SV=1 Back     alignment and function description
>sp|Q60HG1|ERCC3_MACFA TFIIH basal transcription factor complex helicase XPB subunit OS=Macaca fascicularis GN=ERCC3 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZKK7|ERCC3_CHICK TFIIH basal transcription factor complex helicase XPB subunit OS=Gallus gallus GN=ERCC3 PE=2 SV=1 Back     alignment and function description
>sp|Q00578|RAD25_YEAST DNA repair helicase RAD25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSL2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query552
242005969 794 DNA excision repair protein haywire, put 0.610 0.424 0.852 1e-170
307201000 737 TFIIH basal transcription factor complex 0.605 0.453 0.839 1e-167
332022982 793 DNA excision repair protein haywire [Acr 0.603 0.419 0.845 1e-167
383849852 788 PREDICTED: DNA excision repair protein h 0.605 0.423 0.849 1e-167
380015693 795 PREDICTED: DNA excision repair protein h 0.606 0.421 0.839 1e-167
66519335 795 PREDICTED: DNA excision repair protein h 0.606 0.421 0.839 1e-167
380015695 800 PREDICTED: DNA excision repair protein h 0.606 0.418 0.839 1e-167
312383928 834 hypothetical protein AND_02780 [Anophele 0.608 0.402 0.831 1e-166
91078404 778 PREDICTED: similar to rad25/xp-b DNA rep 0.610 0.433 0.853 1e-166
340720531 795 PREDICTED: DNA excision repair protein h 0.605 0.420 0.839 1e-166
>gi|242005969|ref|XP_002423832.1| DNA excision repair protein haywire, putative [Pediculus humanus corporis] gi|212507048|gb|EEB11094.1| DNA excision repair protein haywire, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  603 bits (1556), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 289/339 (85%), Positives = 312/339 (92%), Gaps = 2/339 (0%)

Query: 215 IHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKR 274
           + EVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQ R
Sbjct: 455 LDEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQNR 514

Query: 275 GFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTI 334
           GFIARVQCAEVWCPM+PEFYREYL+C+TSK+LLLYVMNPNK+RA QYLI YHERRGDKTI
Sbjct: 515 GFIARVQCAEVWCPMTPEFYREYLICRTSKKLLLYVMNPNKFRACQYLIRYHERRGDKTI 574

Query: 335 VFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPE 394
           VFSDNVFALKHYA+KMNKP+IYGPTSQ ERIQILQNFK+NPK+NTIFVSKVADTSFDLP+
Sbjct: 575 VFSDNVFALKHYAIKMNKPFIYGPTSQMERIQILQNFKINPKINTIFVSKVADTSFDLPD 634

Query: 395 ANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRF 454
           A+VLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDT+EMSYSRKRQ F
Sbjct: 635 ASVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTIEMSYSRKRQSF 694

Query: 455 LINQGYSYKVITKLAGMEEERGMHYSTRDEQGQLLQQVLAASETDADEERVAGEVGGVSG 514
           L+NQGYSYKVIT+LAGMEEE  M Y TRDEQGQLLQQVLAA++TDA+EER+ GE G    
Sbjct: 695 LVNQGYSYKVITQLAGMEEEPDMFYKTRDEQGQLLQQVLAANDTDAEEERIPGEGGKPGV 754

Query: 515 GFKRSGGTMASLSGADDAVYHESR--FSNVKHPLFKKFR 551
              R  G ++SLSGADDAVY E +   S+VKHPLFKKFR
Sbjct: 755 MAHRRIGNISSLSGADDAVYVEYKKPSSSVKHPLFKKFR 793

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307201000|gb|EFN80971.1| TFIIH basal transcription factor complex helicase XPB subunit [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332022982|gb|EGI63247.1| DNA excision repair protein haywire [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383849852|ref|XP_003700549.1| PREDICTED: DNA excision repair protein haywire-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380015693|ref|XP_003691832.1| PREDICTED: DNA excision repair protein haywire-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|66519335|ref|XP_624125.1| PREDICTED: DNA excision repair protein haywire [Apis mellifera] Back     alignment and taxonomy information
>gi|380015695|ref|XP_003691833.1| PREDICTED: DNA excision repair protein haywire-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|312383928|gb|EFR28807.1| hypothetical protein AND_02780 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|91078404|ref|XP_974506.1| PREDICTED: similar to rad25/xp-b DNA repair helicase [Tribolium castaneum] gi|270003880|gb|EFA00328.1| hypothetical protein TcasGA2_TC003167 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340720531|ref|XP_003398689.1| PREDICTED: DNA excision repair protein haywire-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query552
FB|FBgn0001179798 hay "haywire" [Drosophila mela 0.612 0.423 0.787 1.4e-194
RGD|1307139782 Ercc3 "excision repair cross-c 0.608 0.429 0.752 8.1e-179
UNIPROTKB|P19447782 ERCC3 "TFIIH basal transcripti 0.608 0.429 0.749 1.7e-178
UNIPROTKB|Q60HG1782 ERCC3 "TFIIH basal transcripti 0.608 0.429 0.749 1.7e-178
UNIPROTKB|Q5RA62782 ERCC3 "TFIIH basal transcripti 0.608 0.429 0.749 1.7e-178
UNIPROTKB|G3V1S1718 ERCC3 "Excision repair cross-c 0.608 0.467 0.749 1.7e-178
UNIPROTKB|Q1RMT1782 ERCC3 "TFIIH basal transcripti 0.608 0.429 0.749 1.7e-178
UNIPROTKB|E2RN68779 ERCC3 "Uncharacterized protein 0.608 0.431 0.746 2.1e-178
UNIPROTKB|F1RXZ5782 ERCC3 "Uncharacterized protein 0.608 0.429 0.743 3.5e-178
MGI|MGI:95414783 Ercc3 "excision repair cross-c 0.608 0.429 0.749 5.7e-178
FB|FBgn0001179 hay "haywire" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1400 (497.9 bits), Expect = 1.4e-194, Sum P(2) = 1.4e-194
 Identities = 270/343 (78%), Positives = 301/343 (87%)

Query:   215 IHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKR 274
             + EVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQK+
Sbjct:   456 LDEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKK 515

Query:   275 GFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTI 334
             G+IARVQCAEVWCPMSPEFYREYL  KTSK++LLYVMNP+K+R+ Q+LI YHE+RGDKTI
Sbjct:   516 GYIARVQCAEVWCPMSPEFYREYLTTKTSKKMLLYVMNPSKFRSCQFLIKYHEQRGDKTI 575

Query:   335 VFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPE 394
             VFSDNVFALKHYA+KMNKP+IYGPTSQ+ERIQILQNFK N KVNTIFVSKVADTSFDLPE
Sbjct:   576 VFSDNVFALKHYAIKMNKPFIYGPTSQNERIQILQNFKFNSKVNTIFVSKVADTSFDLPE 635

Query:   395 ANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRF 454
             ANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRF
Sbjct:   636 ANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRF 695

Query:   455 LINQGYSYKVITKLAGMEEERGMHYSTRDEQGQLLQQVLAASETDADEERVAGEXXXXXX 514
             L+NQGYSYKVIT L GM+ +  + Y T++EQGQLLQ VL+AS+ D ++E++ GE      
Sbjct:   696 LVNQGYSYKVITHLKGMDTDSDLMYGTQEEQGQLLQLVLSASDLDCEDEKLPGEPGYRPS 755

Query:   515 XXXXXXXT---MASLSGADDAVYHESRFSNVK--HPLFKKFRG 552
                        ++S+SG DDA+Y+E R  N+   HPLFKKFRG
Sbjct:   756 GSGGAVRRVGGLSSMSGGDDAIYYEHRKKNIGSVHPLFKKFRG 798
GO:0008344 "adult locomotory behavior" evidence=IMP
GO:0004386 "helicase activity" evidence=ISS
GO:0009411 "response to UV" evidence=IMP
GO:0006289 "nucleotide-excision repair" evidence=ISS
GO:0001113 "transcriptional open complex formation at RNA polymerase II promoter" evidence=ISS
GO:0043140 "ATP-dependent 3'-5' DNA helicase activity" evidence=ISS
GO:0005675 "holo TFIIH complex" evidence=ISS;IDA
GO:0001111 "promoter clearance from RNA polymerase II promoter" evidence=ISS
GO:0005634 "nucleus" evidence=IC;NAS;IDA
GO:0004003 "ATP-dependent DNA helicase activity" evidence=NAS
GO:0006367 "transcription initiation from RNA polymerase II promoter" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0000439 "core TFIIH complex" evidence=IEA
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0006366 "transcription from RNA polymerase II promoter" evidence=IMP
RGD|1307139 Ercc3 "excision repair cross-complementing rodent repair deficiency, complementation group 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P19447 ERCC3 "TFIIH basal transcription factor complex helicase XPB subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q60HG1 ERCC3 "TFIIH basal transcription factor complex helicase XPB subunit" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RA62 ERCC3 "TFIIH basal transcription factor complex helicase XPB subunit" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|G3V1S1 ERCC3 "Excision repair cross-complementing rodent repair deficiency, complementation group 3 (Xeroderma pigmentosum group B complementing), isoform CRA_b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q1RMT1 ERCC3 "TFIIH basal transcription factor complex helicase XPB subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RN68 ERCC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RXZ5 ERCC3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:95414 Ercc3 "excision repair cross-complementing rodent repair deficiency, complementation group 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q1RMT1ERCC3_BOVIN3, ., 6, ., 4, ., 1, 20.75800.60860.4296yesN/A
Q8SSK1RAD25_ENCCU3, ., 6, ., 4, ., 1, 20.57400.57600.4568yesN/A
Q38861XPB1_ARATH3, ., 6, ., 4, ., 1, 20.56640.60680.4367yesN/A
Q5ZKK7ERCC3_CHICK3, ., 6, ., 4, ., 1, 20.74410.60140.4213yesN/A
Q7ZVV1ERCC3_DANRE3, ., 6, ., 4, ., 1, 20.76010.60500.4271yesN/A
Q5RA62ERCC3_PONAB3, ., 6, ., 4, ., 1, 20.75800.60860.4296yesN/A
Q9FUG4XPB2_ARATH3, ., 6, ., 4, ., 1, 20.59690.58330.4203yesN/A
O13768ERCC3_SCHPO3, ., 6, ., 4, ., 1, 20.58280.60500.4154yesN/A
O00835ERCC3_DICDI3, ., 6, ., 4, ., 1, 20.56090.60500.4175yesN/A
Q02870ERCC3_DROME3, ., 6, ., 4, ., 1, 20.80230.61050.4223yesN/A
Q4G005ERCC3_RAT3, ., 6, ., 4, ., 1, 20.76380.60860.4296yesN/A
P49135ERCC3_MOUSE3, ., 6, ., 4, ., 1, 20.76090.60860.4291yesN/A
Q00578RAD25_YEAST3, ., 6, ., 4, ., 1, 20.58970.60680.3973yesN/A
P19447ERCC3_HUMAN3, ., 6, ., 4, ., 1, 20.75800.60860.4296yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.120.914
3rd Layer3.6.40.921

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query552
TIGR00603732 TIGR00603, rad25, DNA repair helicase rad25 0.0
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 9e-63
TIGR00603732 TIGR00603, rad25, DNA repair helicase rad25 2e-53
TIGR00603 732 TIGR00603, rad25, DNA repair helicase rad25 2e-30
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 5e-13
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-10
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-09
pfam10278178 pfam10278, Med19, Mediator of RNA pol II transcrip 2e-05
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-05
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 5e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 5e-05
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-04
pfam13625128 pfam13625, Helicase_C_3, Helicase conserved C-term 1e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 5e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 5e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 7e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 7e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 8e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 9e-04
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 0.001
PTZ00074135 PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro 0.001
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.002
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.002
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 0.002
PTZ00074135 PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro 0.002
PTZ00074135 PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro 0.002
pfam0855590 pfam08555, DUF1754, Eukaryotic family of unknown f 0.002
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.004
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 0.004
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 0.004
>gnl|CDD|233046 TIGR00603, rad25, DNA repair helicase rad25 Back     alignment and domain information 
 Score =  625 bits (1614), Expect = 0.0
 Identities = 245/350 (70%), Positives = 283/350 (80%), Gaps = 17/350 (4%)

Query: 217 EVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKRGF 276
           EVH +PA MFRRVLTIVQ+HCKLGLTATL+REDDKI DLNFLIGPKLYEANW+ELQK+GF
Sbjct: 383 EVHVVPAAMFRRVLTIVQAHCKLGLTATLVREDDKITDLNFLIGPKLYEANWMELQKKGF 442

Query: 277 IARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTIVF 336
           IA VQCAEVWCPM+PEFYREYL   + KR+LLYVMNPNK+RA Q+LI +HE+RGDK IVF
Sbjct: 443 IANVQCAEVWCPMTPEFYREYLRENSRKRMLLYVMNPNKFRACQFLIRFHEQRGDKIIVF 502

Query: 337 SDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEAN 396
           SDNVFALK YA+K+ KP+IYGPTSQ ER+QILQNF+ NPKVNTIF+SKV DTS DLPEAN
Sbjct: 503 SDNVFALKEYAIKLGKPFIYGPTSQQERMQILQNFQHNPKVNTIFLSKVGDTSIDLPEAN 562

Query: 397 VLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLI 456
           VLIQISSH GSRRQEAQRLGRILRAKKG+ AEEYNAFFY+LVS+DT EM YS KRQRFL+
Sbjct: 563 VLIQISSHYGSRRQEAQRLGRILRAKKGSDAEEYNAFFYSLVSKDTQEMYYSTKRQRFLV 622

Query: 457 NQGYSYKVITKLAGMEEERGMHYSTRDEQGQLLQQVLAASETDADEERVAGEVGGV---- 512
           +QGYS+KVIT L GM+ E  + YS+++EQ +LLQ+VL A + DA+ E + GE G      
Sbjct: 623 DQGYSFKVITHLPGMDNESNLAYSSKEEQLELLQKVLLAGDLDAELEVLEGEFGSRALGA 682

Query: 513 -------SGGFKRSGGTMASLSGADDAVYHESRFSNVK------HPLFKK 549
                  SG   R GG+++SLSG DD  Y E R   +K      HPLFKK
Sbjct: 683 SRSMSSASGKAVRRGGSLSSLSGGDDMAYMEYRKPAIKKSKKEVHPLFKK 732

All proteins in this family for which functions are known are DNA-DNA helicases used for the initiation of nucleotide excision repair and transacription as part of the TFIIH complex.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 732
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233046 TIGR00603, rad25, DNA repair helicase rad25 Back     alignment and domain information
>gnl|CDD|233046 TIGR00603, rad25, DNA repair helicase rad25 Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|205803 pfam13625, Helicase_C_3, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional Back     alignment and domain information
>gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional Back     alignment and domain information
>gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 552
KOG1123|consensus776 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
KOG0385|consensus 971 100.0
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
KOG0387|consensus 923 100.0
KOG0389|consensus941 100.0
KOG0392|consensus1549 100.0
KOG0384|consensus 1373 100.0
PRK04914 956 ATP-dependent helicase HepA; Validated 100.0
KOG0390|consensus776 100.0
KOG0386|consensus 1157 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
KOG0388|consensus1185 100.0
KOG0331|consensus519 100.0
PTZ00110545 helicase; Provisional 100.0
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.98
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.98
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.97
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.97
KOG1000|consensus689 99.97
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.97
KOG0391|consensus 1958 99.97
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 99.97
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.97
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.97
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.97
KOG0354|consensus746 99.97
KOG0330|consensus476 99.97
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.97
PTZ00424401 helicase 45; Provisional 99.97
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.97
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.97
KOG1015|consensus 1567 99.97
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.97
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.96
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.96
KOG1002|consensus791 99.96
KOG0345|consensus567 99.96
PRK10689 1147 transcription-repair coupling factor; Provisional 99.96
KOG4439|consensus901 99.96
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.96
PRK02362 737 ski2-like helicase; Provisional 99.95
KOG0350|consensus620 99.95
PRK13767 876 ATP-dependent helicase; Provisional 99.95
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.95
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.95
KOG0333|consensus673 99.95
KOG0340|consensus442 99.95
COG4096 875 HsdR Type I site-specific restriction-modification 99.94
KOG0328|consensus400 99.94
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.94
KOG0338|consensus691 99.94
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.94
KOG0342|consensus543 99.94
KOG0336|consensus629 99.94
PRK00254 720 ski2-like helicase; Provisional 99.94
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.93
KOG0343|consensus 758 99.93
PRK01172 674 ski2-like helicase; Provisional 99.93
KOG0339|consensus731 99.92
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.92
KOG0335|consensus482 99.92
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.92
KOG0348|consensus708 99.92
COG1204 766 Superfamily II helicase [General function predicti 99.92
KOG0341|consensus610 99.91
KOG0326|consensus459 99.91
PHA02653675 RNA helicase NPH-II; Provisional 99.91
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.91
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.91
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.9
KOG0347|consensus731 99.9
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.9
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.9
COG1202 830 Superfamily II helicase, archaea-specific [General 99.9
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.9
KOG0332|consensus477 99.9
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.9
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.89
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.89
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.89
KOG0344|consensus593 99.89
KOG1016|consensus 1387 99.88
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.88
KOG0337|consensus529 99.87
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.87
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.87
KOG4284|consensus 980 99.87
COG4889 1518 Predicted helicase [General function prediction on 99.86
PRK09401 1176 reverse gyrase; Reviewed 99.86
KOG0334|consensus 997 99.85
KOG0346|consensus569 99.85
PRK05580679 primosome assembly protein PriA; Validated 99.84
KOG1001|consensus674 99.84
KOG0952|consensus 1230 99.83
COG1205 851 Distinct helicase family with a unique C-terminal 99.83
KOG0327|consensus397 99.82
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.82
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.81
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.79
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.78
PRK14701 1638 reverse gyrase; Provisional 99.77
PRK09694878 helicase Cas3; Provisional 99.77
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.77
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.76
KOG0951|consensus 1674 99.76
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.75
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.75
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.71
KOG0352|consensus 641 99.71
KOG0351|consensus 941 99.71
PRK05298652 excinuclease ABC subunit B; Provisional 99.67
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.64
KOG0329|consensus387 99.64
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.63
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.63
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.63
KOG0353|consensus 695 99.58
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.57
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.56
KOG0349|consensus725 99.53
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.51
KOG0950|consensus 1008 99.51
KOG0947|consensus 1248 99.5
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.5
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.5
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.44
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.44
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.43
KOG0922|consensus 674 99.42
COG0610 962 Type I site-specific restriction-modification syst 99.42
KOG0948|consensus 1041 99.4
smart0049082 HELICc helicase superfamily c-terminal domain. 99.39
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.34
KOG0383|consensus696 99.33
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.32
KOG0953|consensus 700 99.28
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.27
KOG0949|consensus 1330 99.26
KOG0924|consensus 1042 99.26
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.25
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.25
KOG1123|consensus 776 99.23
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.21
KOG0926|consensus 1172 99.12
smart00487201 DEXDc DEAD-like helicases superfamily. 99.11
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.11
KOG0923|consensus 902 99.1
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.04
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.02
KOG0920|consensus 924 99.0
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.98
PRK14873665 primosome assembly protein PriA; Provisional 98.94
PRK15483 986 type III restriction-modification system StyLTI en 98.92
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.92
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.91
KOG0925|consensus 699 98.64
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 98.61
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.57
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 98.57
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.56
KOG0951|consensus1674 98.31
KOG4150|consensus 1034 98.21
COG3587 985 Restriction endonuclease [Defense mechanisms] 98.17
KOG0298|consensus1394 98.14
KOG0298|consensus 1394 98.03
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 97.94
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 97.92
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.9
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.64
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.52
PF13871278 Helicase_C_4: Helicase_C-like 97.41
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.36
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 97.23
PF1324576 AAA_19: Part of AAA domain 97.14
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.13
KOG1802|consensus935 96.98
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 96.88
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 96.7
KOG1513|consensus 1300 96.65
KOG0952|consensus1230 96.64
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 96.4
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 96.39
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.35
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.07
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 95.95
smart00489289 DEXDc3 DEAD-like helicases superfamily. 95.79
smart00488289 DEXDc2 DEAD-like helicases superfamily. 95.79
PRK10536262 hypothetical protein; Provisional 95.72
smart00382148 AAA ATPases associated with a variety of cellular 95.7
smart00492141 HELICc3 helicase superfamily c-terminal domain. 95.32
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 94.91
smart00491142 HELICc2 helicase superfamily c-terminal domain. 94.42
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 94.39
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 94.1
KOG1803|consensus649 93.94
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 93.7
PRK10875615 recD exonuclease V subunit alpha; Provisional 93.48
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 93.4
TIGR00376637 DNA helicase, putative. The gene product may repre 93.26
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 93.19
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 93.09
KOG1805|consensus1100 92.9
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 92.77
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 92.74
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 92.62
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 92.32
PRK04296190 thymidine kinase; Provisional 92.21
PF04364137 DNA_pol3_chi: DNA polymerase III chi subunit, HolC 92.17
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 92.07
cd01124187 KaiC KaiC is a circadian clock protein primarily f 92.06
KOG0701|consensus 1606 91.82
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 91.71
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 91.67
PF11496297 HDA2-3: Class II histone deacetylase complex subun 91.61
PRK05728142 DNA polymerase III subunit chi; Validated 91.21
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 91.15
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 90.62
PRK05580 679 primosome assembly protein PriA; Validated 90.54
PRK08533230 flagellar accessory protein FlaH; Reviewed 90.43
TIGR00595 505 priA primosomal protein N'. All proteins in this f 90.37
KOG0738|consensus491 90.04
TIGR02237209 recomb_radB DNA repair and recombination protein R 90.01
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 89.59
KOG1513|consensus 1300 89.44
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 89.26
KOG0745|consensus564 89.09
PRK14974336 cell division protein FtsY; Provisional 89.06
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 88.94
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 88.88
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 88.73
PRK10867433 signal recognition particle protein; Provisional 88.71
COG1484254 DnaC DNA replication protein [DNA replication, rec 88.6
PF00004132 AAA: ATPase family associated with various cellula 88.39
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 88.27
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 88.26
PRK04328249 hypothetical protein; Provisional 87.98
PRK13342413 recombination factor protein RarA; Reviewed 87.87
KOG0731|consensus774 87.87
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 87.81
PHA03333752 putative ATPase subunit of terminase; Provisional 87.35
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 87.18
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 87.18
PRK14873 665 primosome assembly protein PriA; Provisional 87.1
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 87.08
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 87.0
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 86.98
KOG0651|consensus388 86.43
TIGR00959428 ffh signal recognition particle protein. This mode 86.23
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 86.18
KOG1807|consensus1025 86.07
PRK10689 1147 transcription-repair coupling factor; Provisional 86.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 85.97
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 85.53
PRK12377248 putative replication protein; Provisional 85.51
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 85.23
PRK11054684 helD DNA helicase IV; Provisional 85.23
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 85.14
cd03115173 SRP The signal recognition particle (SRP) mediates 84.84
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 84.84
KOG2340|consensus698 84.73
PRK09354349 recA recombinase A; Provisional 84.57
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 84.55
PRK13341 725 recombination factor protein RarA/unknown domain f 84.24
COG2256436 MGS1 ATPase related to the helicase subunit of the 84.21
PRK08116268 hypothetical protein; Validated 83.95
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 83.49
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 83.47
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 83.23
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 83.17
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 83.15
PRK11823446 DNA repair protein RadA; Provisional 83.13
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 82.96
PRK05973237 replicative DNA helicase; Provisional 82.85
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 82.81
PRK06526254 transposase; Provisional 82.78
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 82.7
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 82.64
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 82.56
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 82.47
PRK06921266 hypothetical protein; Provisional 82.38
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 82.34
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 82.25
PF13625129 Helicase_C_3: Helicase conserved C-terminal domain 81.99
PRK03992389 proteasome-activating nucleotidase; Provisional 81.57
PRK07952244 DNA replication protein DnaC; Validated 81.16
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 80.88
cd01393226 recA_like RecA is a bacterial enzyme which has rol 80.62
PRK06835329 DNA replication protein DnaC; Validated 80.31
PRK08181269 transposase; Validated 80.1
>KOG1123|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.7e-106  Score=810.89  Aligned_cols=461  Identities=66%  Similarity=1.038  Sum_probs=436.7

Q ss_pred             chhhhhhhhhhHHHHHHHHHhhhccCeecCCCCchhHHHHHHHHhcCCcEEEEecCchhHHHHHHHHHhhhCCCCCcEEE
Q psy11640          6 VISGCKKKKKKKKKKKKKKKKKKKKKKKKRPSAGKSLVGVTACCTVRKRALVLCNSGVSVEQWKHQFKLWSTADDSMICR   85 (552)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~vlpTG~GKTl~ai~~i~~~~~~~LIl~Pt~~Lv~Qw~~e~~~~~~~~~~~I~~   85 (552)
                      +|+--|+|--.|-|--   -+-+-.++|||||+|||+++++++++.++++||||.+.+.|+||+.+|+.|.++.+..|++
T Consensus       302 ~iRpYQEksL~KMFGN---gRARSGiIVLPCGAGKtLVGvTAa~tikK~clvLcts~VSVeQWkqQfk~wsti~d~~i~r  378 (776)
T KOG1123|consen  302 QIRPYQEKSLSKMFGN---GRARSGIIVLPCGAGKTLVGVTAACTIKKSCLVLCTSAVSVEQWKQQFKQWSTIQDDQICR  378 (776)
T ss_pred             ccCchHHHHHHHHhCC---CcccCceEEEecCCCCceeeeeeeeeecccEEEEecCccCHHHHHHHHHhhcccCccceEE
Confidence            4555565554444421   2567789999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCcccCC-CCCcEEEEcccccccccccchhHHHHHHHHhcCcccEEEEccCCcccccccccccCCCCCcccccchhhh
Q psy11640         86 FTSEAKDKP-MGCGILVTTYSMISHTQKRSWEADQTMQWLQNQEWGIMLLDDGVPVAAKKNVEKDDAAVPEDEFGAKDYR  164 (552)
Q Consensus        86 ~~g~~~~~~-~~~~IvItTy~~l~~~~~~~~~~~~~~~~l~~~~~~liIvDE~h~~~~~~~~~~~~~~~~~~~f~~~d~~  164 (552)
                      |+++.++++ .+++|+|+||+|+++.++||+++++.|++|..++|+++|+|                             
T Consensus       379 FTsd~Ke~~~~~~gvvvsTYsMva~t~kRS~eaek~m~~l~~~EWGllllD-----------------------------  429 (776)
T KOG1123|consen  379 FTSDAKERFPSGAGVVVTTYSMVAYTGKRSHEAEKIMDFLRGREWGLLLLD-----------------------------  429 (776)
T ss_pred             eeccccccCCCCCcEEEEeeehhhhcccccHHHHHHHHHHhcCeeeeEEee-----------------------------
Confidence            999999964 77999999999999999999999999999999999999999                             


Q ss_pred             hhhhcCCCCCCCCccccCCCccccccccchhhhhhHHHHHhhcCCCCCccccceeecchhHHHHHHHhhhccceeeecce
Q psy11640        165 AQMVLKPDHKSRPLWVAPNGHIFLESFSPVYRHAHDFLIAIAEPVCRPEHIHEVHTIPAKMFRRVLTIVQSHCKLGLTAT  244 (552)
Q Consensus       165 ~~~~l~~~~~~r~~~~~~~g~i~~~~~~~~~~~~~d~~~~~~~~~~r~~~~~E~~~~~~~~~~~~l~~~~~~~~lgLTAT  244 (552)
                                                                          |+|.+|+.+||+++..++++|+||||||
T Consensus       430 ----------------------------------------------------EVHvvPA~MFRRVlsiv~aHcKLGLTAT  457 (776)
T KOG1123|consen  430 ----------------------------------------------------EVHVVPAKMFRRVLSIVQAHCKLGLTAT  457 (776)
T ss_pred             ----------------------------------------------------hhccchHHHHHHHHHHHHHHhhccceeE
Confidence                                                                9999999999999999999999999999


Q ss_pred             ecccccchhhhhhhhcccccccCHHHHHHcCCCcceEEEEEEcCCCHHHHHHHHhhhhhhhhhHHhcCchhHHHHHHHHH
Q psy11640        245 LLREDDKIADLNFLIGPKLYEANWLELQKRGFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIA  324 (552)
Q Consensus       245 p~r~d~~~~~L~~lig~~~~~~~~~el~~~g~l~~~~~~~v~~~l~~~~~~~y~~~~~~~~~~~~~~~~~K~~~l~~Ll~  324 (552)
                      ++|+|+++.+|+++|||++|+++|++|.+.|+|++++|.+|||||++++|++|+....+++.++++|||+|+++|+.||+
T Consensus       458 LvREDdKI~DLNFLIGPKlYEAnWmdL~~kGhIA~VqCaEVWCpMt~eFy~eYL~~~t~kr~lLyvMNP~KFraCqfLI~  537 (776)
T KOG1123|consen  458 LVREDDKITDLNFLIGPKLYEANWMDLQKKGHIAKVQCAEVWCPMTPEFYREYLRENTRKRMLLYVMNPNKFRACQFLIK  537 (776)
T ss_pred             EeeccccccccceeecchhhhccHHHHHhCCceeEEeeeeeecCCCHHHHHHHHhhhhhhhheeeecCcchhHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCeEEEEeccHHHHHHHHHHcCCceEeCCCCHHHHHHHHHhhccCCCeeEEEEeCccccccCCCCCCEEEEeccC
Q psy11640        325 YHERRGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEANVLIQISSH  404 (552)
Q Consensus       325 ~~~~~g~kvIVF~~~~~~~~~l~~~L~~~~i~G~~~~~eR~~il~~F~~~g~~~vLv~T~v~~~GlDlp~a~~VI~~~~~  404 (552)
                      +|+.+|+|+|||++++..+..++-.|+.++|+|.|++.||.+||++|+.|+.+|.||.|+||++.||||+|+|+|++++|
T Consensus       538 ~HE~RgDKiIVFsDnvfALk~YAikl~KpfIYG~Tsq~ERm~ILqnFq~n~~vNTIFlSKVgDtSiDLPEAnvLIQISSH  617 (776)
T KOG1123|consen  538 FHERRGDKIIVFSDNVFALKEYAIKLGKPFIYGPTSQNERMKILQNFQTNPKVNTIFLSKVGDTSIDLPEANVLIQISSH  617 (776)
T ss_pred             HHHhcCCeEEEEeccHHHHHHHHHHcCCceEECCCchhHHHHHHHhcccCCccceEEEeeccCccccCCcccEEEEEccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChhhHHHHhhhccccCCCCCCCceeEEEEEEecCCchhhHHHHHHHHHHHHcCCCeeEeecccccccccCCCCCChHH
Q psy11640        405 GGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLINQGYSYKVITKLAGMEEERGMHYSTRDE  484 (552)
Q Consensus       405 ~~s~~q~~Qr~GRi~R~~~~k~~~~~~v~vy~lvs~~t~e~~~~~~r~~~l~~~g~~~~v~~~~~~~~~~~~~~~~~~~~  484 (552)
                      .+|++|..||+|||+|++.. +.+++|+|||+||++||.||+|+.+||+||++|||+|+||+++.+|++.+++.|.|+++
T Consensus       618 ~GSRRQEAQRLGRILRAKk~-~de~fnafFYSLVS~DTqEM~YStKRQ~FLidQGYsfkVit~L~gme~~~~l~y~skee  696 (776)
T KOG1123|consen  618 GGSRRQEAQRLGRILRAKKR-NDEEFNAFFYSLVSKDTQEMYYSTKRQQFLIDQGYSFKVITNLPGMENLEDLAYASKEE  696 (776)
T ss_pred             ccchHHHHHHHHHHHHHhhc-CccccceeeeeeeecchHHHHhhhhhhhhhhhcCceEEEeecCCCcCcCcccccCCHHH
Confidence            99999999999999999975 45999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhccccchhhhhhccccCCCCCCccccccccccccCCCCceeeeeccCCC------CCchhhhhcC
Q psy11640        485 QGQLLQQVLAASETDADEERVAGEVGGVSGGFKRSGGTMASLSGADDAVYHESRFSNV------KHPLFKKFRG  552 (552)
Q Consensus       485 ~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~  552 (552)
                      |.+|||.||.++|.++|+|..+++ ...++.+.|+.|+|++|||||||+|+|++.+.+      .||+|+.||+
T Consensus       697 q~~LLq~Vl~a~d~~~e~E~~~~~-~~~~~~a~r~~gslssmsGgd~m~Y~ey~~~~~k~~~~~~~p~~~~~r~  769 (776)
T KOG1123|consen  697 QLELLQKVLLASDLDAELEDLEDE-SRASSKAVRSEGSLSSMSGGDDMAYMEYNSSRNKKLIKSVHPLFKRFRK  769 (776)
T ss_pred             HHHHHHHHHhcchhhhcccccccc-ccccccceecccccccccCCCcceeeeeccccccccccccccchhHHHH
Confidence            999999999999999999988777 355678999999999999999999999997665      5999999885

>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PF04364 DNA_pol3_chi: DNA polymerase III chi subunit, HolC; InterPro: IPR007459 The DNA polymerase III holoenzyme (2 Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>KOG0701|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi Back     alignment and domain information
>PRK05728 DNA polymerase III subunit chi; Validated Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG1807|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF13625 Helicase_C_3: Helicase conserved C-terminal domain Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query552
4ern_A289 Crystal Structure Of The C-terminal Domain Of Human 1e-122
2fwr_A472 Structure Of Archaeoglobus Fulgidis Xpb Length = 47 3e-16
2fzl_A219 Structure Of C-Terminal Domain Of Archaeoglobus Ful 5e-10
>pdb|4ERN|A Chain A, Crystal Structure Of The C-terminal Domain Of Human Xpb/ercc-3 Excision Repair Protein At 1.80 A Length = 289 Back     alignment and structure 
Iteration: 1

 Score =  435 bits (1119), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 207/289 (71%), Positives = 240/289 (83%), Gaps = 7/289 (2%)
Query: 269 LELQKRGFIARVQCAEVWCPMSPEFYREYLVCKTSKRLLLYVMNPNKYRATQYLIAYHER 328
           +ELQ  G+IA+VQCAEVWCPMSPEFYREY+  KT KR+LLY MNPNK+RA Q+LI +HER
Sbjct: 1   MELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHER 60
Query: 329 RGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADT 388
           R DK IVF+DNVFALK YA+++NKPYIYGPTSQ ER+QILQNFK NPK+NTIF+SKV DT
Sbjct: 61  RNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDT 120
Query: 389 SFDLPEANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYS 448
           SFDLPEANVLIQISSHGGSRRQEAQRLGR+LRAKKG +AEEYNAFFY+LVSQDT EM+YS
Sbjct: 121 SFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYS 180
Query: 449 RKRQRFLINQGYSYKVITKLAGMEEERGMHYSTRDEQGQLLQQVLAASETDADEERVAGE 508
            KRQRFL++QGYS+KVITKLAGMEEE  + +ST++EQ QLLQ+VLAA++ DA+EE VAGE
Sbjct: 181 TKRQRFLVDQGYSFKVITKLAGMEEE-DLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGE 239
Query: 509 XXXXXXXXXXXXXTMASLSGADDAVYHESRFSNVK------HPLFKKFR 551
                        TM+S+SGADD VY E   S  K      HPLFK+FR
Sbjct: 240 FGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRFR 288
>pdb|2FWR|A Chain A, Structure Of Archaeoglobus Fulgidis Xpb Length = 472 Back     alignment and structure
>pdb|2FZL|A Chain A, Structure Of C-Terminal Domain Of Archaeoglobus Fulgidus Xpb Length = 219 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query552
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 3e-78
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 6e-17
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 6e-17
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 5e-05
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 5e-04
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
 Score =  253 bits (647), Expect = 3e-78
 Identities = 73/286 (25%), Positives = 126/286 (44%), Gaps = 50/286 (17%)

Query: 215 IHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKR 274
             EVH +PA+ + ++  +  +  +LGLTAT  RED +   L  ++G K++E     L   
Sbjct: 198 FDEVHHLPAESYVQIAQMSIAPFRLGLTATFEREDGRHEILKEVVGGKVFELFPDSLAG- 256

Query: 275 GFIARVQCAEVWCPMSPEFYREYLVCKTS------------------------------- 303
             +A+     ++ P++ +   EY   +                                 
Sbjct: 257 KHLAKYTIKRIFVPLAEDERVEYEKREKVYKQFLRARGITLRRAEDFNKIVMASGYDERA 316

Query: 304 --------KRLLLYVMNPNKYRATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPYI 355
                   +   +   + NK R  + ++  H  R DK I+F+ +   +   +     P I
Sbjct: 317 YEALRAWEEARRIAFNSKNKIRKLREILERH--RKDKIIIFTRHNELVYRISKVFLIPAI 374

Query: 356 YGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEANVLIQISSHGGSRRQEAQRL 415
              TS+ ER +IL+ F+   +   I  S+V D   D+P+ANV + + S  GS R+  QRL
Sbjct: 375 THRTSREEREEILEGFR-TGRFRAIVSSQVLDEGIDVPDANVGVIM-SGSGSAREYIQRL 432

Query: 416 GRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLINQGYS 461
           GRILR  KG    +  A  Y L+S+ T E++ +R+R+     +G +
Sbjct: 433 GRILRPSKG----KKEAVLYELISRGTGEVNTARRRK--NAAKGAA 472
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query552
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.98
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.98
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.98
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.97
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.97
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.97
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.97
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.97
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.97
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.97
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.97
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.97
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.97
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.96
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.96
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.96
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.96
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.95
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.95
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.95
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.95
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.95
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.93
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.92
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.92
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.92
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.92
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.92
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.91
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.91
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.91
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.9
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.9
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.9
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.9
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.9
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.9
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.88
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.86
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.86
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.82
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.82
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.81
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.81
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.79
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.79
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.79
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.79
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.78
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.75
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.59
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.74
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.73
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.6
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.53
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.52
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.49
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.49
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.48
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.47
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.47
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.46
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.46
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.46
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.45
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.45
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.45
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.42
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 99.42
3bor_A237 Human initiation factor 4A-II; translation initiat 99.42
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.41
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.4
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.28
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.04
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.52
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.45
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.23
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 96.8
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 96.77
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 96.52
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.39
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 95.94
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 95.58
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 95.21
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 93.89
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 92.09
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 91.7
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 90.4
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 89.48
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 88.87
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 88.85
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 88.68
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 88.65
3sxu_A150 DNA polymerase III subunit CHI; DNA replication, C 88.18
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 88.12
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 86.99
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 86.76
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 86.51
1tue_A212 Replication protein E1; helicase, replication, E1E 86.07
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 84.38
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 84.07
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 83.53
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 83.4
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 83.11
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 83.11
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 82.47
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 82.3
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 81.81
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 81.15
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 81.02
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 80.85
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 80.82
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 80.14
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
Probab=100.00  E-value=7.8e-45  Score=391.61  Aligned_cols=318  Identities=27%  Similarity=0.391  Sum_probs=260.6

Q ss_pred             hccCeecCCCCchhHHHHHHHHhcCCcEEEEecCchhHHHHHHHHHhhhCCCCCc-EEEEecCcccCCCCCcEEEEcccc
Q psy11640         28 KKKKKKKRPSAGKSLVGVTACCTVRKRALVLCNSGVSVEQWKHQFKLWSTADDSM-ICRFTSEAKDKPMGCGILVTTYSM  106 (552)
Q Consensus        28 ~~~~~vlpTG~GKTl~ai~~i~~~~~~~LIl~Pt~~Lv~Qw~~e~~~~~~~~~~~-I~~~~g~~~~~~~~~~IvItTy~~  106 (552)
                      +..++++|||+|||++++.++...+.++|||||+++|+.||.++|.+| +   .. +.+++|+...   ..+|+|+||++
T Consensus       109 ~~~ll~~~TGsGKT~~~l~~i~~~~~~~Lvl~P~~~L~~Q~~~~~~~~-~---~~~v~~~~g~~~~---~~~Ivv~T~~~  181 (472)
T 2fwr_A          109 KRGCIVLPTGSGKTHVAMAAINELSTPTLIVVPTLALAEQWKERLGIF-G---EEYVGEFSGRIKE---LKPLTVSTYDS  181 (472)
T ss_dssp             TEEEEECCTTSCHHHHHHHHHHHHCSCEEEEESSHHHHHHHHHHGGGG-C---GGGEEEBSSSCBC---CCSEEEEEHHH
T ss_pred             CCEEEEeCCCCCHHHHHHHHHHHcCCCEEEEECCHHHHHHHHHHHHhC-C---CcceEEECCCcCC---cCCEEEEEcHH
Confidence            358999999999999999999988999999999999999999999995 3   35 8999887754   47899999998


Q ss_pred             cccccccchhHHHHHHHHhcCcccEEEEccCCcccccccccccCCCCCcccccchhhhhhhhcCCCCCCCCccccCCCcc
Q psy11640        107 ISHTQKRSWEADQTMQWLQNQEWGIMLLDDGVPVAAKKNVEKDDAAVPEDEFGAKDYRAQMVLKPDHKSRPLWVAPNGHI  186 (552)
Q Consensus       107 l~~~~~~~~~~~~~~~~l~~~~~~liIvDE~h~~~~~~~~~~~~~~~~~~~f~~~d~~~~~~l~~~~~~r~~~~~~~g~i  186 (552)
                      +...          .+.+ ...|++||+||+|+                                               
T Consensus       182 l~~~----------~~~~-~~~~~liIvDEaH~-----------------------------------------------  203 (472)
T 2fwr_A          182 AYVN----------AEKL-GNRFMLLIFDEVHH-----------------------------------------------  203 (472)
T ss_dssp             HHHT----------HHHH-TTTCSEEEEETGGG-----------------------------------------------
T ss_pred             HHHH----------HHHh-cCCCCEEEEECCcC-----------------------------------------------
Confidence            8532          2223 25699999997665                                               


Q ss_pred             ccccccchhhhhhHHHHHhhcCCCCCccccceeecchhHHHHHHHhhhccceeeecceecccccchhhhhhhhccccccc
Q psy11640        187 FLESFSPVYRHAHDFLIAIAEPVCRPEHIHEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEA  266 (552)
Q Consensus       187 ~~~~~~~~~~~~~d~~~~~~~~~~r~~~~~E~~~~~~~~~~~~l~~~~~~~~lgLTATp~r~d~~~~~L~~lig~~~~~~  266 (552)
                                                        .....|+.++..+++.++|+|||||.+.|+....+..++||..+..
T Consensus       204 ----------------------------------~~~~~~~~~~~~~~~~~~l~lSATp~~~~~~~~~l~~~~~~~~~~~  249 (472)
T 2fwr_A          204 ----------------------------------LPAESYVQIAQMSIAPFRLGLTATFEREDGRHEILKEVVGGKVFEL  249 (472)
T ss_dssp             ----------------------------------TTSTTTHHHHHTCCCSEEEEEESCCCCTTSGGGSHHHHTCCEEEEC
T ss_pred             ----------------------------------CCChHHHHHHHhcCCCeEEEEecCccCCCCHHHHHHHHhCCeEeec
Confidence                                              3333445567777888999999999999998889999999999999


Q ss_pred             CHHHHHHcCCCcceEEEEEEcCCCHHHHHHHHhhhhh---------------------------------------hhhh
Q psy11640        267 NWLELQKRGFIARVQCAEVWCPMSPEFYREYLVCKTS---------------------------------------KRLL  307 (552)
Q Consensus       267 ~~~el~~~g~l~~~~~~~v~~~l~~~~~~~y~~~~~~---------------------------------------~~~~  307 (552)
                      .+.++ ..+++.++.+..+.+++++++...|......                                       ....
T Consensus       250 ~~~~l-~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  328 (472)
T 2fwr_A          250 FPDSL-AGKHLAKYTIKRIFVPLAEDERVEYEKREKVYKQFLRARGITLRRAEDFNKIVMASGYDERAYEALRAWEEARR  328 (472)
T ss_dssp             CHHHH-TSCCCCSEEECCEEECCCHHHHHHTTTTTHHHHSCSSSCCCTTTCCSSSTTTTTTTCCSSSSSTTTHHHHHHHH
T ss_pred             CHHHH-hcCcCCCeEEEEEEcCCCHHHHHHHHHHHHHHHHHHHhcCccccchhhHHHHHHHhccCHHHHHHHHHHHHHHH
Confidence            99998 6889999988888899988776554321100                                       0111


Q ss_pred             HHhcCchhHHHHHHHHHHHhhcCCeEEEEeccHHHHHHHHHHcCCceEeCCCCHHHHHHHHHhhccCCCeeEEEEeCccc
Q psy11640        308 LYVMNPNKYRATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVAD  387 (552)
Q Consensus       308 ~~~~~~~K~~~l~~Ll~~~~~~g~kvIVF~~~~~~~~~l~~~L~~~~i~G~~~~~eR~~il~~F~~~g~~~vLv~T~v~~  387 (552)
                      ..+..+.|...+.+++..+  .+.++||||+++..++.++..|++..+||+++..+|+++++.|++ |+++|||+|++++
T Consensus       329 ~~~~~~~k~~~l~~~l~~~--~~~k~lvF~~~~~~~~~l~~~l~~~~~~g~~~~~~R~~~~~~F~~-g~~~vLv~T~~~~  405 (472)
T 2fwr_A          329 IAFNSKNKIRKLREILERH--RKDKIIIFTRHNELVYRISKVFLIPAITHRTSREEREEILEGFRT-GRFRAIVSSQVLD  405 (472)
T ss_dssp             HHHSCSHHHHHHHHHHHHT--SSSCBCCBCSCHHHHHHHHHHTTCCBCCSSSCSHHHHTHHHHHHH-SSCSBCBCSSCCC
T ss_pred             HhhcChHHHHHHHHHHHhC--CCCcEEEEECCHHHHHHHHHHhCcceeeCCCCHHHHHHHHHHHhC-CCCCEEEEcCchh
Confidence            2345667889998888875  789999999999999999999999999999999999999999996 8999999999999


Q ss_pred             cccCCCCCCEEEEeccCCCChhhHHHHhhhccccCCCCCCCceeEEEEEEecCCchhhHHHHHHHH
Q psy11640        388 TSFDLPEANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQR  453 (552)
Q Consensus       388 ~GlDlp~a~~VI~~~~~~~s~~q~~Qr~GRi~R~~~~k~~~~~~v~vy~lvs~~t~e~~~~~~r~~  453 (552)
                      +|+|+|++++||+++ +++|+.++.||+||+||.+++|.    .|++|+|++.+|+|+.++.+|++
T Consensus       406 ~Gldlp~~~~Vi~~~-~~~s~~~~~Q~~GR~~R~g~~k~----~~~i~~lv~~~t~ee~~~~~r~~  466 (472)
T 2fwr_A          406 EGIDVPDANVGVIMS-GSGSAREYIQRLGRILRPSKGKK----EAVLYELISRGTGEVNTARRRKN  466 (472)
T ss_dssp             SSSCSCCBSEEEEEC-CSSCCHHHHHHHHHSBCCCTTTC----CEEEEEEEECSCC----------
T ss_pred             cCcccccCcEEEEEC-CCCCHHHHHHHHhhccCCCCCCc----eEEEEEEEeCCCchHHHHHHHHH
Confidence            999999999999999 59999999999999999998732    69999999999999999998874
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sxu_A DNA polymerase III subunit CHI; DNA replication, CHI binds to SSB and PSI, transferase; HET: DNA; 1.85A {Escherichia coli} SCOP: c.128.1.1 PDB: 1em8_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 552
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 6e-13
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 5e-08
d1rifa_282 c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 3e-05
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 2e-04
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DNA repair protein RAD25
species: Archaeoglobus fulgidus [TaxId: 2234]

 Score = 65.7 bits (159), Expect = 6e-13
 Identities = 49/148 (33%), Positives = 72/148 (48%), Gaps = 9/148 (6%)

Query: 295 REYLVCKTSKRLLLYVMNPNKYRATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPY 354
            E L      R +    + NK R  + ++  H  R DK I+F+ +   +   +     P 
Sbjct: 61  YEALRAWEEARRIA-FNSKNKIRKLREILERH--RKDKIIIFTRHNELVYRISKVFLIPA 117

Query: 355 IYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEANVLIQISSHGGSRRQEAQR 414
           I   TS+ ER +IL+ F+       I  S+V D   D+P+ANV + +S   GS R+  QR
Sbjct: 118 ITHRTSREEREEILEGFRTGR-FRAIVSSQVLDEGIDVPDANVGVIMSGS-GSAREYIQR 175

Query: 415 LGRILRAKKGAIAEEYNAFFYTLVSQDT 442
           LGRILR  KG    +  A  Y L+S+ T
Sbjct: 176 LGRILRPSKG----KKEAVLYELISRGT 199
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Length = 282 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query552
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.93
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.89
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.88
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.88
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.85
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.84
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.84
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.84
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.83
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.82
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.82
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.82
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.8
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.79
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.79
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.78
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.65
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.65
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.64
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.62
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.61
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.61
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.6
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.54
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.49
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.48
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.46
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.41
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.4
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.36
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.33
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.33
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.3
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.26
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.25
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.14
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.02
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.98
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 98.75
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.71
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.52
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.49
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.45
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 97.22
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 96.9
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 96.64
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.15
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.79
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 95.05
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.86
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 94.22
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 93.86
d2qy9a2211 GTPase domain of the signal recognition particle r 92.93
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 92.62
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.74
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.67
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 91.64
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 90.7
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 90.15
d1ls1a2207 GTPase domain of the signal sequence recognition p 90.05
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 89.99
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 89.84
d1em8a_147 DNA polymerase III chi subunit {Escherichia coli [ 89.69
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 89.31
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 89.11
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 88.44
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 88.34
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 87.36
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 86.56
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 85.53
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 85.32
d1okkd2207 GTPase domain of the signal recognition particle r 85.05
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 84.53
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 83.99
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 83.66
d1svma_362 Papillomavirus large T antigen helicase domain {Si 83.36
d1vmaa2213 GTPase domain of the signal recognition particle r 83.32
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 82.78
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 82.63
d1j8yf2211 GTPase domain of the signal sequence recognition p 81.73
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 80.94
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 80.73
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 80.55
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 80.46
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 80.13
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DNA repair protein RAD25
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=99.93  E-value=4.2e-26  Score=214.99  Aligned_cols=159  Identities=31%  Similarity=0.446  Sum_probs=138.9

Q ss_pred             CCcceEEEEEEcCCCHHHHHHHHhhhhh---------------------------------------hhhhHHhcCchhH
Q psy11640        276 FIARVQCAEVWCPMSPEFYREYLVCKTS---------------------------------------KRLLLYVMNPNKY  316 (552)
Q Consensus       276 ~l~~~~~~~v~~~l~~~~~~~y~~~~~~---------------------------------------~~~~~~~~~~~K~  316 (552)
                      +|+|+.+..+.++|++++...|......                                       ....+....++|+
T Consensus         2 ~L~py~v~~i~V~Lt~~E~~~Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~K~   81 (200)
T d2fwra1           2 HLAKYTIKRIFVPLAEDERVEYEKREKVYKQFLRARGITLRRAEDFNKIVMASGYDERAYEALRAWEEARRIAFNSKNKI   81 (200)
T ss_dssp             CCCSEEECCEEECCCHHHHHHTTTTTHHHHSCSSSCCCTTTCCSSSTTTTTTTCCSSSSSTTTHHHHHHHHHHHSCSHHH
T ss_pred             cCCCcEEEEEEecCCHHHHHHHHHHHHHHHHHHHhcccchhhhHHHHHHHHHhcCCHHHHHHHHHHHHHHHHhhCcHHHH
Confidence            6889999999999999988776543210                                       0111233456799


Q ss_pred             HHHHHHHHHHhhcCCeEEEEeccHHHHHHHHHHcCCceEeCCCCHHHHHHHHHhhccCCCeeEEEEeCccccccCCCCCC
Q psy11640        317 RATQYLIAYHERRGDKTIVFSDNVFALKHYAVKMNKPYIYGPTSQSERIQILQNFKLNPKVNTIFVSKVADTSFDLPEAN  396 (552)
Q Consensus       317 ~~l~~Ll~~~~~~g~kvIVF~~~~~~~~~l~~~L~~~~i~G~~~~~eR~~il~~F~~~g~~~vLv~T~v~~~GlDlp~a~  396 (552)
                      ..|.++++.+  .+.++||||++..+++.|++.|++..+||+++..+|+.++++|++ |+++|||+|+++++|||+|.++
T Consensus        82 ~~l~~ll~~~--~~~k~lvf~~~~~~~~~l~~~l~~~~i~g~~~~~~R~~~l~~F~~-~~~~vLv~~~~~~~Gidl~~~~  158 (200)
T d2fwra1          82 RKLREILERH--RKDKIIIFTRHNELVYRISKVFLIPAITHRTSREEREEILEGFRT-GRFRAIVSSQVLDEGIDVPDAN  158 (200)
T ss_dssp             HHHHHHHHHT--SSSCBCCBCSCHHHHHHHHHHTTCCBCCSSSCSHHHHTHHHHHHH-SSCSBCBCSSCCCSSSCSCCBS
T ss_pred             HHHHHHHHhC--CCCcEEEEeCcHHHHHHHHhhcCcceeeCCCCHHHHHHHHHHhhc-CCeeeeeecchhhcccCCCCCC
Confidence            9999999876  788999999999999999999999999999999999999999996 8999999999999999999999


Q ss_pred             EEEEeccCCCChhhHHHHhhhccccCCCCCCCceeEEEEEEecCCc
Q psy11640        397 VLIQISSHGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDT  442 (552)
Q Consensus       397 ~VI~~~~~~~s~~q~~Qr~GRi~R~~~~k~~~~~~v~vy~lvs~~t  442 (552)
                      +||+++ ++||+.+++||+||++|.++++.    .++||+||+.||
T Consensus       159 ~vi~~~-~~~s~~~~~Q~iGR~~R~~~~k~----~~~i~~~v~~~T  199 (200)
T d2fwra1         159 VGVIMS-GSGSAREYIQRLGRILRPSKGKK----EAVLYELISRGT  199 (200)
T ss_dssp             EEEEEC-CSSCCHHHHHHHHHSBCCCTTTC----CEEEEEEEECSC
T ss_pred             EEEEeC-CCCCHHHHHHHHHhcCCCCCCCc----EEEEEEEecCCC
Confidence            999999 69999999999999999999765    699999999987
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1em8a_ c.128.1.1 (A:) DNA polymerase III chi subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure