Diaphorina citri psyllid: psy11667

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MVNSRARSNTSVRAISKDLPPSTPRPGKNSPAGGKPTTAGGTTVAGGCVKKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKVVRI
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEcccccccccccccccccccccHHHHHHHHHHHHcccccccccccc
***********************************************************AQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKVVRI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNSRARSNTSVRAISKDLPPSTPRPGKNSPAGGKPTTAGGTTVAGGCVKKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKVVRI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger A20 and AN1 domain-containing stress-associated protein 7 May be involved in environmental stress response.confidentQ9SZ69

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044424 [CC]intracellular partprobableGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WFF, chain A
Confidence level:very confident
Coverage over the Query: 50-114
View the alignment between query and template
View the model in PyMOL