Psyllid ID: psy11667


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MVNSRARSNTSVRAISKDLPPSTPRPGKNSPAGGKPTTAGGTTVAGGCVKKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKVVRI
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccHHHHHHHHHHHHcccccccccccc
cccccccccccHccHHccccccccccccccccccccccccccccccccccccccccccccHHccEEEEEcccEEcccccEEEEEEccccccccccHHHHHHHHHHHHccEEEccccccc
mvnsrarsntSVRAiskdlppstprpgknspaggkpttaggttvaggcvkktkhkrsrcaqcnakltvcssftcrcrklfcprhrhpeehactfdykaYGRHLLAATNPLVVADKVVRI
mvnsrarsntsvraiskdlppstprpgknspaggkpttaggttvaggcvkktkhkrsrcaqcnakltvcssftCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAatnplvvadkvvri
MVNSRARSNTSVRAISKDLPPSTPRPGKNSpaggkpttaggttvaggcvkktkHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKVVRI
*******************************************VAGGCVKKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKV***
*************************************************************CNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKVVRI
************RAISKDL********************GGTTVAGGC***********AQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKVVRI
*******************************************************RSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKV*R*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNSRARSNTSVRAISKDLPPSTPRPGKNSPAGGKPTTAGGTTVAGGCVKKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKVVRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query119 2.2.26 [Sep-21-2011]
Q9SZ69175 Zinc finger A20 and AN1 d yes N/A 0.521 0.354 0.523 2e-12
Q6NNI8168 Zinc finger A20 and AN1 d no N/A 0.554 0.392 0.492 3e-12
Q0DJC7174 Zinc finger AN1 domain-co yes N/A 0.521 0.356 0.476 5e-12
Q852K8237 Zinc finger AN1 domain-co no N/A 0.504 0.253 0.508 7e-12
Q852K5160 Zinc finger A20 and AN1 d no N/A 0.521 0.387 0.476 2e-11
Q6H7P8173 Zinc finger A20 and AN1 d no N/A 0.705 0.485 0.364 4e-11
Q852K6169 Zinc finger A20 and AN1 d no N/A 0.504 0.355 0.491 4e-11
Q9STJ9130 Zinc finger A20 and AN1 d no N/A 0.588 0.538 0.464 4e-11
O49663176 Zinc finger A20 and AN1 d no N/A 0.521 0.352 0.460 1e-10
Q6H754154 Zinc finger A20 and AN1 d no N/A 0.495 0.383 0.5 1e-10
>sp|Q9SZ69|SAP7_ARATH Zinc finger A20 and AN1 domain-containing stress-associated protein 7 OS=Arabidopsis thaliana GN=SAP7 PE=1 SV=1 Back     alignment and function desciption
 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 1/63 (1%)

Query: 57  SRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKV 116
           +RC  CN K+ V   F C+C   FC  HR+PE+H C+FD+K  GR  +A  NPLV ADKV
Sbjct: 114 NRCFSCNKKVGV-MGFKCKCGSTFCGSHRYPEKHECSFDFKEVGRDAIAKANPLVKADKV 172

Query: 117 VRI 119
            RI
Sbjct: 173 QRI 175




May be involved in environmental stress response.
Arabidopsis thaliana (taxid: 3702)
>sp|Q6NNI8|SAP1_ARATH Zinc finger A20 and AN1 domain-containing stress-associated protein 1 OS=Arabidopsis thaliana GN=SAP1 PE=1 SV=1 Back     alignment and function description
>sp|Q0DJC7|SAP15_ORYSJ Zinc finger AN1 domain-containing stress-associated protein 15 OS=Oryza sativa subsp. japonica GN=SAP15 PE=2 SV=1 Back     alignment and function description
>sp|Q852K8|SAP14_ORYSJ Zinc finger AN1 domain-containing stress-associated protein 14 OS=Oryza sativa subsp. japonica GN=SAP14 PE=2 SV=1 Back     alignment and function description
>sp|Q852K5|SAP6_ORYSJ Zinc finger A20 and AN1 domain-containing stress-associated protein 6 OS=Oryza sativa subsp. japonica GN=SAP6 PE=2 SV=1 Back     alignment and function description
>sp|Q6H7P8|SAP4_ORYSJ Zinc finger A20 and AN1 domain-containing stress-associated protein 4 OS=Oryza sativa subsp. japonica GN=SAP4 PE=2 SV=1 Back     alignment and function description
>sp|Q852K6|SAP7_ORYSJ Zinc finger A20 and AN1 domain-containing stress-associated protein 7 OS=Oryza sativa subsp. japonica GN=SAP7 PE=2 SV=1 Back     alignment and function description
>sp|Q9STJ9|SAP10_ARATH Zinc finger A20 and AN1 domain-containing stress-associated protein 10 OS=Arabidopsis thaliana GN=SAP10 PE=2 SV=1 Back     alignment and function description
>sp|O49663|SAP9_ARATH Zinc finger A20 and AN1 domain-containing stress-associated protein 9 OS=Arabidopsis thaliana GN=SAP9 PE=2 SV=1 Back     alignment and function description
>sp|Q6H754|SAP5_ORYSJ Zinc finger A20 and AN1 domain-containing stress-associated protein 5 OS=Oryza sativa subsp. japonica GN=SAP5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query119
312374946 1705 hypothetical protein AND_15312 [Anophele 0.815 0.056 0.435 1e-14
347966512 1634 AGAP001757-PA [Anopheles gambiae str. PE 0.588 0.042 0.5 1e-14
91088643 563 PREDICTED: similar to mCG129107 [Triboli 0.546 0.115 0.507 1e-14
157138611 1122 hypothetical protein AaeL_AAEL003901 [Ae 0.865 0.091 0.386 4e-14
221105965 539 PREDICTED: AN1-type zinc finger protein 0.571 0.126 0.514 3e-13
242011970 393 conserved hypothetical protein [Pediculu 0.672 0.203 0.433 3e-13
193683464 477 PREDICTED: hypothetical protein LOC10016 0.563 0.140 0.492 7e-13
449667337208 PREDICTED: uncharacterized protein LOC10 0.974 0.557 0.353 8e-13
170034821 693 conserved hypothetical protein [Culex qu 0.747 0.128 0.377 9e-13
432874718208 PREDICTED: AN1-type zinc finger protein 0.882 0.504 0.367 3e-12
>gi|312374946|gb|EFR22405.1| hypothetical protein AND_15312 [Anopheles darlingi] Back     alignment and taxonomy information
 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 57/101 (56%), Gaps = 4/101 (3%)

Query: 21   PSTPRPGKNSPAGGKPTTAGGTTVAGG--CVKKTKHKRSRCAQCNAKLTVCSSFTCRCRK 78
            PS    G+   AGG   T  G   A      ++ K K+ RCAQCN KL V     C C K
Sbjct: 1607 PSAVNAGEE--AGGNRATGVGYEAAQEQHSTEQIKSKKLRCAQCNKKLGVIMIMKCHCEK 1664

Query: 79   LFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKVVRI 119
            +FC +HR+ E H C++D+K  GR LL   NPLVVA+K+ +I
Sbjct: 1665 IFCAQHRYAEAHNCSYDFKLQGRKLLERENPLVVAEKLPKI 1705




Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|347966512|ref|XP_001689324.2| AGAP001757-PA [Anopheles gambiae str. PEST] gi|333470027|gb|EDO63229.2| AGAP001757-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|91088643|ref|XP_974406.1| PREDICTED: similar to mCG129107 [Tribolium castaneum] gi|270011686|gb|EFA08134.1| hypothetical protein TcasGA2_TC005738 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157138611|ref|XP_001664278.1| hypothetical protein AaeL_AAEL003901 [Aedes aegypti] gi|108880566|gb|EAT44791.1| AAEL003901-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|221105965|ref|XP_002169026.1| PREDICTED: AN1-type zinc finger protein 4-like [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|242011970|ref|XP_002426716.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212510887|gb|EEB13978.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|193683464|ref|XP_001946679.1| PREDICTED: hypothetical protein LOC100168628 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|449667337|ref|XP_004206543.1| PREDICTED: uncharacterized protein LOC101241548 [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|170034821|ref|XP_001845271.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167876401|gb|EDS39784.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|432874718|ref|XP_004072558.1| PREDICTED: AN1-type zinc finger protein 5-like isoform 1 [Oryzias latipes] gi|432874720|ref|XP_004072559.1| PREDICTED: AN1-type zinc finger protein 5-like isoform 2 [Oryzias latipes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query119
TAIR|locus:2132649176 AT4G22820 [Arabidopsis thalian 0.529 0.357 0.453 9.2e-15
TAIR|locus:2118036175 SAP7 "stress-associated protei 0.521 0.354 0.523 4.9e-14
UNIPROTKB|A7MBA8213 ZFAND5 "ZFAND5 protein" [Bos t 0.537 0.300 0.430 7.9e-14
UNIPROTKB|E2RMV3213 ZFAND5 "Uncharacterized protei 0.537 0.300 0.430 7.9e-14
UNIPROTKB|O76080213 ZFAND5 "AN1-type zinc finger p 0.537 0.300 0.430 7.9e-14
UNIPROTKB|A4U9C9213 LOC100737314 "Zinc finger prot 0.537 0.300 0.430 7.9e-14
UNIPROTKB|I3LS37206 ZFAND5 "Uncharacterized protei 0.537 0.310 0.430 7.9e-14
MGI|MGI:1278334213 Zfand5 "zinc finger, AN1-type 0.537 0.300 0.430 7.9e-14
RGD|1310776213 Zfand5 "zinc finger, AN1-type 0.537 0.300 0.430 7.9e-14
UNIPROTKB|F1NJD4212 ZFAND5 "Uncharacterized protei 0.537 0.301 0.430 1.6e-13
TAIR|locus:2132649 AT4G22820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 166 (63.5 bits), Expect = 9.2e-15, Sum P(2) = 9.2e-15
 Identities = 29/64 (45%), Positives = 40/64 (62%)

Query:    55 KRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVAD 114
             + +RC  CN K+ +   F C+C   FC  HR+PE H C+FD+K  GR  +A  NP+V AD
Sbjct:   113 RTNRCLCCNKKVGIMG-FKCKCGSTFCGEHRYPETHDCSFDFKEVGRGEIAKANPVVKAD 171

Query:   115 KVVR 118
             K+ R
Sbjct:   172 KIQR 175


GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
GO:0010200 "response to chitin" evidence=RCA
TAIR|locus:2118036 SAP7 "stress-associated protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBA8 ZFAND5 "ZFAND5 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RMV3 ZFAND5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O76080 ZFAND5 "AN1-type zinc finger protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A4U9C9 LOC100737314 "Zinc finger protein 216" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LS37 ZFAND5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1278334 Zfand5 "zinc finger, AN1-type domain 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310776 Zfand5 "zinc finger, AN1-type domain 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJD4 ZFAND5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SZ69SAP7_ARATHNo assigned EC number0.52380.52100.3542yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
pfam0142843 pfam01428, zf-AN1, AN1-like Zinc finger 2e-06
smart0015439 smart00154, ZnF_AN1, AN1-like Zinc finger 3e-05
>gnl|CDD|201791 pfam01428, zf-AN1, AN1-like Zinc finger Back     alignment and domain information
 Score = 41.7 bits (98), Expect = 2e-06
 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 72 FTCR-CRKLFCPRHRHPEEHACTFDYKA 98
          F CR C   FC +HR PE+H C   YK+
Sbjct: 14 FKCRFCGGTFCLKHRLPEDHNCPGLYKS 41


Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis. The following pattern describes the zinc finger. C-X2-C-X(9-12)-C-X(1-2)-C-X4-C-X2-H-X5-H-X-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Length = 43

>gnl|CDD|197545 smart00154, ZnF_AN1, AN1-like Zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 119
KOG3173|consensus167 99.93
smart0015439 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C 99.51
PF0142843 zf-AN1: AN1-like Zinc finger; InterPro: IPR000058 99.15
KOG3183|consensus250 97.65
COG3582162 Predicted nucleic acid binding protein containing 97.6
KOG3183|consensus 250 96.99
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 94.0
cd0006557 FYVE FYVE domain; Zinc-binding domain; targets pro 91.98
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 91.82
smart0006468 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 91.68
KOG1818|consensus 634 86.05
PF15135278 UPF0515: Uncharacterised protein UPF0515 80.36
PF0013053 C1_1: Phorbol esters/diacylglycerol binding domain 80.1
>KOG3173|consensus Back     alignment and domain information
Probab=99.93  E-value=2.4e-26  Score=175.78  Aligned_cols=69  Identities=45%  Similarity=0.962  Sum_probs=64.9

Q ss_pred             ccCCcCCCcccccccccccccceeeccCCcccCCCCCCCCCCCccccHHhhHHHHHHhCCcccccccccC
Q psy11667         50 KKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKVVRI  119 (119)
Q Consensus        50 ~~~~~~k~RC~~C~kkl~Ls~~f~CrCg~~FC~~HR~pe~H~C~fDyk~~gr~~Lak~NP~v~~~Kl~ki  119 (119)
                      ....+.++||+.|+|++|| ++|.||||++||..|||+|.|+|.||||.+||+.|+++||+|+++||.||
T Consensus        99 ~~~~~~~~rC~~C~kk~gl-tgf~CrCG~~fC~~HRy~e~H~C~fDyK~~gr~~i~k~nP~v~a~k~~ki  167 (167)
T KOG3173|consen   99 ESKPKKKKRCFKCRKKVGL-TGFKCRCGNTFCGTHRYPEQHDCSFDYKQAGREKIAKANPVVKADKLQKI  167 (167)
T ss_pred             ccccccchhhhhhhhhhcc-cccccccCCcccccccCCccccccccHHHHHHHHHHHhCCeeeccccccC
Confidence            4455677889999999999 78999999999999999999999999999999999999999999999998



>smart00154 ZnF_AN1 AN1-like Zinc finger Back     alignment and domain information
>PF01428 zf-AN1: AN1-like Zinc finger; InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3183|consensus Back     alignment and domain information
>COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3183|consensus Back     alignment and domain information
>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
>KOG1818|consensus Back     alignment and domain information
>PF15135 UPF0515: Uncharacterised protein UPF0515 Back     alignment and domain information
>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
1wff_A85 Solution Structure Of The Zf-An1 Domain From Mouse 1e-08
1wfp_A74 Solution Structure Of The Zf-an1 Domain From Arabio 5e-07
1wg2_A64 Solution Structure Of Zf-An1 Domain From Arabidopsi 7e-07
1wfh_A64 Solution Structrue Of The Zf-An1 Domain From Arabid 2e-06
1wfl_A74 Solution Structure Of The Zf-An1 Domain From Mouse 7e-06
1x4w_A67 Solution Structure Of The Zf-An1 Domain From Human 9e-06
>pdb|1WFF|A Chain A, Solution Structure Of The Zf-An1 Domain From Mouse Riken Cdna 2810002d23 Protein Length = 85 Back     alignment and structure

Iteration: 1

Score = 54.7 bits (130), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 23/52 (44%), Positives = 29/52 (55%) Query: 59 CAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPL 110 C C K + +SF CRC FC HR+ E H C +DYK+ GR L NP+ Sbjct: 28 CFLCGKKTGLATSFECRCGNNFCASHRYAEAHGCNYDYKSAGRRYLEEANPV 79
>pdb|1WFP|A Chain A, Solution Structure Of The Zf-an1 Domain From Arabiopsis Thaliana F5o11.17 Protein Length = 74 Back     alignment and structure
>pdb|1WG2|A Chain A, Solution Structure Of Zf-An1 Domain From Arabidopsis Thaliana Length = 64 Back     alignment and structure
>pdb|1WFH|A Chain A, Solution Structrue Of The Zf-An1 Domain From Arabidopsis Thaliana At2g36320 Protein Length = 64 Back     alignment and structure
>pdb|1WFL|A Chain A, Solution Structure Of The Zf-An1 Domain From Mouse Zinc Finger Protein 216 Length = 74 Back     alignment and structure
>pdb|1X4W|A Chain A, Solution Structure Of The Zf-An1 Domain From Human Hypothetical Protein Flj13222 Length = 67 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
1wff_A85 Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc 1e-20
1wfh_A64 Zinc finger (AN1-like) family protein; ZF-AN1 doma 5e-16
1wg2_A64 Zinc finger (AN1-like) family protein; riken struc 1e-15
1wfp_A74 Zinc finger (AN1-like) family protein; ZF-AN1 doma 2e-15
1wfl_A74 Zinc finger protein 216; ZF-AN1 domain, zinc bindi 2e-15
1x4w_A67 Hypothetical protein FLJ13222; ZF-AN1 domain, zinc 3e-15
1x4v_A63 Hypothetical protein LOC130617; ZF-AN1 domain, zin 2e-04
1wfe_A86 Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc 8e-04
>1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Length = 85 Back     alignment and structure
 Score = 78.4 bits (193), Expect = 1e-20
 Identities = 24/65 (36%), Positives = 32/65 (49%)

Query: 49  VKKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATN 108
           ++  K     C  C  K  + +SF CRC   FC  HR+ E H C +DYK+ GR  L   N
Sbjct: 18  LQTKKKIMKHCFLCGKKTGLATSFECRCGNNFCASHRYAEAHGCNYDYKSAGRRYLEEAN 77

Query: 109 PLVVA 113
           P+   
Sbjct: 78  PVSGP 82


>1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Length = 64 Back     alignment and structure
>1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Length = 64 Back     alignment and structure
>1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Length = 74 Back     alignment and structure
>1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Length = 74 Back     alignment and structure
>1x4w_A Hypothetical protein FLJ13222; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1x4v_A Hypothetical protein LOC130617; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1wfe_A Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Length = 86 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query119
1wff_A85 Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc 99.95
1wfl_A74 Zinc finger protein 216; ZF-AN1 domain, zinc bindi 99.91
1wg2_A64 Zinc finger (AN1-like) family protein; riken struc 99.9
1wfh_A64 Zinc finger (AN1-like) family protein; ZF-AN1 doma 99.9
1wfp_A74 Zinc finger (AN1-like) family protein; ZF-AN1 doma 99.9
1x4w_A67 Hypothetical protein FLJ13222; ZF-AN1 domain, zinc 99.87
1wfe_A86 Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc 99.37
1x4v_A63 Hypothetical protein LOC130617; ZF-AN1 domain, zin 99.37
1wys_A75 Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc 99.24
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 93.5
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 92.91
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 92.78
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 92.53
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 92.23
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 92.21
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 91.86
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 91.79
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 90.23
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 89.48
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 83.75
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 82.46
>1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
Probab=99.95  E-value=8.7e-30  Score=176.56  Aligned_cols=65  Identities=37%  Similarity=0.795  Sum_probs=61.0

Q ss_pred             ccCCcCCCcccccccccccccceeeccCCcccCCCCCCCCCCCccccHHhhHHHHHHhCCccccc
Q psy11667         50 KKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVAD  114 (119)
Q Consensus        50 ~~~~~~k~RC~~C~kkl~Ls~~f~CrCg~~FC~~HR~pe~H~C~fDyk~~gr~~Lak~NP~v~~~  114 (119)
                      ..+++.++||+.|+++|+|+++|+||||++||++|||+|+|+|+||||++||++|+++||+|+++
T Consensus        19 ~~~k~~~~rC~~C~kkvgl~~~f~CrCg~~FC~~HRy~e~H~C~fDyK~~gr~~iak~NPvV~a~   83 (85)
T 1wff_A           19 QTKKKIMKHCFLCGKKTGLATSFECRCGNNFCASHRYAEAHGCNYDYKSAGRRYLEEANPVSGPS   83 (85)
T ss_dssp             CCCCCCCCBCSSSCCBCSSSSCEECTTCCEECTTTCSTGGGTCCSCCSSSCCCCCCCCCCCCCTT
T ss_pred             ccCcccCccchhhCCeecccCCeEcCCCCEecccCCCccCCCCcchhhHHHHHHHHHHCCeecCC
Confidence            34577789999999999996699999999999999999999999999999999999999999986



>1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>1x4w_A Hypothetical protein FLJ13222; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfe_A Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>1x4v_A Hypothetical protein LOC130617; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wys_A Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc binding, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 119
d1wffa_85 g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog 2e-20
d1wfha_64 g.80.1.1 (A:) Zinc finger A20 and AN1 domains cont 7e-15
d1wfla_74 g.80.1.1 (A:) Zinc finger A20 domain containing pr 5e-14
d1wfpa_74 g.80.1.1 (A:) Zinc finger A20 and AN1 domains cont 6e-14
d1wfea_86 g.80.1.1 (A:) AN1-type zinc finger protein 1 {Mous 6e-05
>d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure

class: Small proteins
fold: AN1-like Zinc finger
superfamily: AN1-like Zinc finger
family: AN1-like Zinc finger
domain: ANUBL1 (AN1, ubiquitin-like, homolog)
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 76.8 bits (189), Expect = 2e-20
 Identities = 24/65 (36%), Positives = 32/65 (49%)

Query: 49  VKKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATN 108
           ++  K     C  C  K  + +SF CRC   FC  HR+ E H C +DYK+ GR  L   N
Sbjct: 18  LQTKKKIMKHCFLCGKKTGLATSFECRCGNNFCASHRYAEAHGCNYDYKSAGRRYLEEAN 77

Query: 109 PLVVA 113
           P+   
Sbjct: 78  PVSGP 82


>d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 74 Back     information, alignment and structure
>d1wfea_ g.80.1.1 (A:) AN1-type zinc finger protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query119
d1wffa_85 ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus 99.94
d1wfla_74 Zinc finger A20 domain containing protein 2 {Mouse 99.89
d1wfpa_74 Zinc finger A20 and AN1 domains containing protein 99.89
d1wfha_64 Zinc finger A20 and AN1 domains containing protein 99.89
d1wfea_86 AN1-type zinc finger protein 1 {Mouse (Mus musculu 98.64
d1wfka_88 Zinc finger FYVE domain containing protein 19 {Mou 95.19
d1vfya_67 vps27p protein {Baker's yeast (Saccharomyces cerev 93.55
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 92.56
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 92.47
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 91.48
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 89.99
d1r79a_84 Diacylglycerol kinase delta {Human (Homo sapiens) 87.38
d1tbna_66 Protein kinase c-gamma {Rat (Rattus rattus) [TaxId 84.46
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 80.49
>d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: AN1-like Zinc finger
superfamily: AN1-like Zinc finger
family: AN1-like Zinc finger
domain: ANUBL1 (AN1, ubiquitin-like, homolog)
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.94  E-value=7.1e-29  Score=170.35  Aligned_cols=66  Identities=36%  Similarity=0.792  Sum_probs=60.9

Q ss_pred             cccCCcCCCcccccccccccccceeeccCCcccCCCCCCCCCCCccccHHhhHHHHHHhCCccccc
Q psy11667         49 VKKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVAD  114 (119)
Q Consensus        49 ~~~~~~~k~RC~~C~kkl~Ls~~f~CrCg~~FC~~HR~pe~H~C~fDyk~~gr~~Lak~NP~v~~~  114 (119)
                      ...+++.++||++|+++|+|.++|+||||+.||++|||||+|+|+|||++.||++|+++||+|.+.
T Consensus        18 ~~~kk~~~~RC~~C~KKl~l~~~~~CrCg~~FC~~HR~pe~H~CtfDyK~~~k~~L~k~NP~i~p~   83 (85)
T d1wffa_          18 LQTKKKIMKHCFLCGKKTGLATSFECRCGNNFCASHRYAEAHGCNYDYKSAGRRYLEEANPVSGPS   83 (85)
T ss_dssp             CCCCCCCCCBCSSSCCBCSSSSCEECTTCCEECTTTCSTGGGTCCSCCSSSCCCCCCCCCCCCCTT
T ss_pred             cccccccCCcChhcCCeecCCcCeecCCCCEehhhcCCCcCcCCCcchHHHHHHHHHHHCCccCCC
Confidence            455666778999999999997799999999999999999999999999999999999999999874



>d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wfea_ g.80.1.1 (A:) AN1-type zinc finger protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure