Psyllid ID: psy11667
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 119 | ||||||
| 312374946 | 1705 | hypothetical protein AND_15312 [Anophele | 0.815 | 0.056 | 0.435 | 1e-14 | |
| 347966512 | 1634 | AGAP001757-PA [Anopheles gambiae str. PE | 0.588 | 0.042 | 0.5 | 1e-14 | |
| 91088643 | 563 | PREDICTED: similar to mCG129107 [Triboli | 0.546 | 0.115 | 0.507 | 1e-14 | |
| 157138611 | 1122 | hypothetical protein AaeL_AAEL003901 [Ae | 0.865 | 0.091 | 0.386 | 4e-14 | |
| 221105965 | 539 | PREDICTED: AN1-type zinc finger protein | 0.571 | 0.126 | 0.514 | 3e-13 | |
| 242011970 | 393 | conserved hypothetical protein [Pediculu | 0.672 | 0.203 | 0.433 | 3e-13 | |
| 193683464 | 477 | PREDICTED: hypothetical protein LOC10016 | 0.563 | 0.140 | 0.492 | 7e-13 | |
| 449667337 | 208 | PREDICTED: uncharacterized protein LOC10 | 0.974 | 0.557 | 0.353 | 8e-13 | |
| 170034821 | 693 | conserved hypothetical protein [Culex qu | 0.747 | 0.128 | 0.377 | 9e-13 | |
| 432874718 | 208 | PREDICTED: AN1-type zinc finger protein | 0.882 | 0.504 | 0.367 | 3e-12 |
| >gi|312374946|gb|EFR22405.1| hypothetical protein AND_15312 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
Score = 84.0 bits (206), Expect = 1e-14, Method: Compositional matrix adjust.
Identities = 44/101 (43%), Positives = 57/101 (56%), Gaps = 4/101 (3%)
Query: 21 PSTPRPGKNSPAGGKPTTAGGTTVAGG--CVKKTKHKRSRCAQCNAKLTVCSSFTCRCRK 78
PS G+ AGG T G A ++ K K+ RCAQCN KL V C C K
Sbjct: 1607 PSAVNAGEE--AGGNRATGVGYEAAQEQHSTEQIKSKKLRCAQCNKKLGVIMIMKCHCEK 1664
Query: 79 LFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKVVRI 119
+FC +HR+ E H C++D+K GR LL NPLVVA+K+ +I
Sbjct: 1665 IFCAQHRYAEAHNCSYDFKLQGRKLLERENPLVVAEKLPKI 1705
|
Source: Anopheles darlingi Species: Anopheles darlingi Genus: Anopheles Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|347966512|ref|XP_001689324.2| AGAP001757-PA [Anopheles gambiae str. PEST] gi|333470027|gb|EDO63229.2| AGAP001757-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|91088643|ref|XP_974406.1| PREDICTED: similar to mCG129107 [Tribolium castaneum] gi|270011686|gb|EFA08134.1| hypothetical protein TcasGA2_TC005738 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|157138611|ref|XP_001664278.1| hypothetical protein AaeL_AAEL003901 [Aedes aegypti] gi|108880566|gb|EAT44791.1| AAEL003901-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|221105965|ref|XP_002169026.1| PREDICTED: AN1-type zinc finger protein 4-like [Hydra magnipapillata] | Back alignment and taxonomy information |
|---|
| >gi|242011970|ref|XP_002426716.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212510887|gb|EEB13978.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|193683464|ref|XP_001946679.1| PREDICTED: hypothetical protein LOC100168628 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|449667337|ref|XP_004206543.1| PREDICTED: uncharacterized protein LOC101241548 [Hydra magnipapillata] | Back alignment and taxonomy information |
|---|
| >gi|170034821|ref|XP_001845271.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167876401|gb|EDS39784.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|432874718|ref|XP_004072558.1| PREDICTED: AN1-type zinc finger protein 5-like isoform 1 [Oryzias latipes] gi|432874720|ref|XP_004072559.1| PREDICTED: AN1-type zinc finger protein 5-like isoform 2 [Oryzias latipes] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 119 | ||||||
| TAIR|locus:2132649 | 176 | AT4G22820 [Arabidopsis thalian | 0.529 | 0.357 | 0.453 | 9.2e-15 | |
| TAIR|locus:2118036 | 175 | SAP7 "stress-associated protei | 0.521 | 0.354 | 0.523 | 4.9e-14 | |
| UNIPROTKB|A7MBA8 | 213 | ZFAND5 "ZFAND5 protein" [Bos t | 0.537 | 0.300 | 0.430 | 7.9e-14 | |
| UNIPROTKB|E2RMV3 | 213 | ZFAND5 "Uncharacterized protei | 0.537 | 0.300 | 0.430 | 7.9e-14 | |
| UNIPROTKB|O76080 | 213 | ZFAND5 "AN1-type zinc finger p | 0.537 | 0.300 | 0.430 | 7.9e-14 | |
| UNIPROTKB|A4U9C9 | 213 | LOC100737314 "Zinc finger prot | 0.537 | 0.300 | 0.430 | 7.9e-14 | |
| UNIPROTKB|I3LS37 | 206 | ZFAND5 "Uncharacterized protei | 0.537 | 0.310 | 0.430 | 7.9e-14 | |
| MGI|MGI:1278334 | 213 | Zfand5 "zinc finger, AN1-type | 0.537 | 0.300 | 0.430 | 7.9e-14 | |
| RGD|1310776 | 213 | Zfand5 "zinc finger, AN1-type | 0.537 | 0.300 | 0.430 | 7.9e-14 | |
| UNIPROTKB|F1NJD4 | 212 | ZFAND5 "Uncharacterized protei | 0.537 | 0.301 | 0.430 | 1.6e-13 |
| TAIR|locus:2132649 AT4G22820 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 166 (63.5 bits), Expect = 9.2e-15, Sum P(2) = 9.2e-15
Identities = 29/64 (45%), Positives = 40/64 (62%)
Query: 55 KRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVAD 114
+ +RC CN K+ + F C+C FC HR+PE H C+FD+K GR +A NP+V AD
Sbjct: 113 RTNRCLCCNKKVGIMG-FKCKCGSTFCGEHRYPETHDCSFDFKEVGRGEIAKANPVVKAD 171
Query: 115 KVVR 118
K+ R
Sbjct: 172 KIQR 175
|
|
| TAIR|locus:2118036 SAP7 "stress-associated protein 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7MBA8 ZFAND5 "ZFAND5 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RMV3 ZFAND5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O76080 ZFAND5 "AN1-type zinc finger protein 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4U9C9 LOC100737314 "Zinc finger protein 216" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LS37 ZFAND5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1278334 Zfand5 "zinc finger, AN1-type domain 5" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1310776 Zfand5 "zinc finger, AN1-type domain 5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NJD4 ZFAND5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 119 | |||
| pfam01428 | 43 | pfam01428, zf-AN1, AN1-like Zinc finger | 2e-06 | |
| smart00154 | 39 | smart00154, ZnF_AN1, AN1-like Zinc finger | 3e-05 |
| >gnl|CDD|201791 pfam01428, zf-AN1, AN1-like Zinc finger | Back alignment and domain information |
|---|
Score = 41.7 bits (98), Expect = 2e-06
Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%)
Query: 72 FTCR-CRKLFCPRHRHPEEHACTFDYKA 98
F CR C FC +HR PE+H C YK+
Sbjct: 14 FKCRFCGGTFCLKHRLPEDHNCPGLYKS 41
|
Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis. The following pattern describes the zinc finger. C-X2-C-X(9-12)-C-X(1-2)-C-X4-C-X2-H-X5-H-X-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Length = 43 |
| >gnl|CDD|197545 smart00154, ZnF_AN1, AN1-like Zinc finger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 119 | |||
| KOG3173|consensus | 167 | 99.93 | ||
| smart00154 | 39 | ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C | 99.51 | |
| PF01428 | 43 | zf-AN1: AN1-like Zinc finger; InterPro: IPR000058 | 99.15 | |
| KOG3183|consensus | 250 | 97.65 | ||
| COG3582 | 162 | Predicted nucleic acid binding protein containing | 97.6 | |
| KOG3183|consensus | 250 | 96.99 | ||
| PF01363 | 69 | FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f | 94.0 | |
| cd00065 | 57 | FYVE FYVE domain; Zinc-binding domain; targets pro | 91.98 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 91.82 | |
| smart00064 | 68 | FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | 91.68 | |
| KOG1818|consensus | 634 | 86.05 | ||
| PF15135 | 278 | UPF0515: Uncharacterised protein UPF0515 | 80.36 | |
| PF00130 | 53 | C1_1: Phorbol esters/diacylglycerol binding domain | 80.1 |
| >KOG3173|consensus | Back alignment and domain information |
|---|
Probab=99.93 E-value=2.4e-26 Score=175.78 Aligned_cols=69 Identities=45% Similarity=0.962 Sum_probs=64.9
Q ss_pred ccCCcCCCcccccccccccccceeeccCCcccCCCCCCCCCCCccccHHhhHHHHHHhCCcccccccccC
Q psy11667 50 KKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVADKVVRI 119 (119)
Q Consensus 50 ~~~~~~k~RC~~C~kkl~Ls~~f~CrCg~~FC~~HR~pe~H~C~fDyk~~gr~~Lak~NP~v~~~Kl~ki 119 (119)
....+.++||+.|+|++|| ++|.||||++||..|||+|.|+|.||||.+||+.|+++||+|+++||.||
T Consensus 99 ~~~~~~~~rC~~C~kk~gl-tgf~CrCG~~fC~~HRy~e~H~C~fDyK~~gr~~i~k~nP~v~a~k~~ki 167 (167)
T KOG3173|consen 99 ESKPKKKKRCFKCRKKVGL-TGFKCRCGNTFCGTHRYPEQHDCSFDYKQAGREKIAKANPVVKADKLQKI 167 (167)
T ss_pred ccccccchhhhhhhhhhcc-cccccccCCcccccccCCccccccccHHHHHHHHHHHhCCeeeccccccC
Confidence 4455677889999999999 78999999999999999999999999999999999999999999999998
|
|
| >smart00154 ZnF_AN1 AN1-like Zinc finger | Back alignment and domain information |
|---|
| >PF01428 zf-AN1: AN1-like Zinc finger; InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3183|consensus | Back alignment and domain information |
|---|
| >COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3183|consensus | Back alignment and domain information |
|---|
| >PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | Back alignment and domain information |
|---|
| >KOG1818|consensus | Back alignment and domain information |
|---|
| >PF15135 UPF0515: Uncharacterised protein UPF0515 | Back alignment and domain information |
|---|
| >PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 119 | ||||
| 1wff_A | 85 | Solution Structure Of The Zf-An1 Domain From Mouse | 1e-08 | ||
| 1wfp_A | 74 | Solution Structure Of The Zf-an1 Domain From Arabio | 5e-07 | ||
| 1wg2_A | 64 | Solution Structure Of Zf-An1 Domain From Arabidopsi | 7e-07 | ||
| 1wfh_A | 64 | Solution Structrue Of The Zf-An1 Domain From Arabid | 2e-06 | ||
| 1wfl_A | 74 | Solution Structure Of The Zf-An1 Domain From Mouse | 7e-06 | ||
| 1x4w_A | 67 | Solution Structure Of The Zf-An1 Domain From Human | 9e-06 |
| >pdb|1WFF|A Chain A, Solution Structure Of The Zf-An1 Domain From Mouse Riken Cdna 2810002d23 Protein Length = 85 | Back alignment and structure |
|
| >pdb|1WFP|A Chain A, Solution Structure Of The Zf-an1 Domain From Arabiopsis Thaliana F5o11.17 Protein Length = 74 | Back alignment and structure |
| >pdb|1WG2|A Chain A, Solution Structure Of Zf-An1 Domain From Arabidopsis Thaliana Length = 64 | Back alignment and structure |
| >pdb|1WFH|A Chain A, Solution Structrue Of The Zf-An1 Domain From Arabidopsis Thaliana At2g36320 Protein Length = 64 | Back alignment and structure |
| >pdb|1WFL|A Chain A, Solution Structure Of The Zf-An1 Domain From Mouse Zinc Finger Protein 216 Length = 74 | Back alignment and structure |
| >pdb|1X4W|A Chain A, Solution Structure Of The Zf-An1 Domain From Human Hypothetical Protein Flj13222 Length = 67 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 119 | |||
| 1wff_A | 85 | Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc | 1e-20 | |
| 1wfh_A | 64 | Zinc finger (AN1-like) family protein; ZF-AN1 doma | 5e-16 | |
| 1wg2_A | 64 | Zinc finger (AN1-like) family protein; riken struc | 1e-15 | |
| 1wfp_A | 74 | Zinc finger (AN1-like) family protein; ZF-AN1 doma | 2e-15 | |
| 1wfl_A | 74 | Zinc finger protein 216; ZF-AN1 domain, zinc bindi | 2e-15 | |
| 1x4w_A | 67 | Hypothetical protein FLJ13222; ZF-AN1 domain, zinc | 3e-15 | |
| 1x4v_A | 63 | Hypothetical protein LOC130617; ZF-AN1 domain, zin | 2e-04 | |
| 1wfe_A | 86 | Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc | 8e-04 |
| >1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Length = 85 | Back alignment and structure |
|---|
Score = 78.4 bits (193), Expect = 1e-20
Identities = 24/65 (36%), Positives = 32/65 (49%)
Query: 49 VKKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATN 108
++ K C C K + +SF CRC FC HR+ E H C +DYK+ GR L N
Sbjct: 18 LQTKKKIMKHCFLCGKKTGLATSFECRCGNNFCASHRYAEAHGCNYDYKSAGRRYLEEAN 77
Query: 109 PLVVA 113
P+
Sbjct: 78 PVSGP 82
|
| >1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Length = 64 | Back alignment and structure |
|---|
| >1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Length = 64 | Back alignment and structure |
|---|
| >1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Length = 74 | Back alignment and structure |
|---|
| >1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Length = 74 | Back alignment and structure |
|---|
| >1x4w_A Hypothetical protein FLJ13222; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1x4v_A Hypothetical protein LOC130617; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >1wfe_A Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Length = 86 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 119 | |||
| 1wff_A | 85 | Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc | 99.95 | |
| 1wfl_A | 74 | Zinc finger protein 216; ZF-AN1 domain, zinc bindi | 99.91 | |
| 1wg2_A | 64 | Zinc finger (AN1-like) family protein; riken struc | 99.9 | |
| 1wfh_A | 64 | Zinc finger (AN1-like) family protein; ZF-AN1 doma | 99.9 | |
| 1wfp_A | 74 | Zinc finger (AN1-like) family protein; ZF-AN1 doma | 99.9 | |
| 1x4w_A | 67 | Hypothetical protein FLJ13222; ZF-AN1 domain, zinc | 99.87 | |
| 1wfe_A | 86 | Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc | 99.37 | |
| 1x4v_A | 63 | Hypothetical protein LOC130617; ZF-AN1 domain, zin | 99.37 | |
| 1wys_A | 75 | Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc | 99.24 | |
| 1vfy_A | 73 | Phosphatidylinositol-3-phosphate binding FYVE doma | 93.5 | |
| 1wfk_A | 88 | Zinc finger, FYVE domain containing 19; riken stru | 92.91 | |
| 2yw8_A | 82 | RUN and FYVE domain-containing protein 1; structur | 92.78 | |
| 1joc_A | 125 | EEA1, early endosomal autoantigen 1; FYVE domain, | 92.53 | |
| 1dvp_A | 220 | HRS, hepatocyte growth factor-regulated tyrosine k | 92.23 | |
| 1x4u_A | 84 | Zinc finger, FYVE domain containing 27 isoform B; | 92.21 | |
| 1z2q_A | 84 | LM5-1; membrane protein, FYVE domain, zinc-finger; | 91.86 | |
| 3zyq_A | 226 | Hepatocyte growth factor-regulated tyrosine kinas | 91.79 | |
| 3t7l_A | 90 | Zinc finger FYVE domain-containing protein 16; str | 90.23 | |
| 1y02_A | 120 | CARP2, FYVE-ring finger protein sakura; zinc-bindi | 89.48 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 83.75 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 82.46 |
| >1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 | Back alignment and structure |
|---|
Probab=99.95 E-value=8.7e-30 Score=176.56 Aligned_cols=65 Identities=37% Similarity=0.795 Sum_probs=61.0
Q ss_pred ccCCcCCCcccccccccccccceeeccCCcccCCCCCCCCCCCccccHHhhHHHHHHhCCccccc
Q psy11667 50 KKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVAD 114 (119)
Q Consensus 50 ~~~~~~k~RC~~C~kkl~Ls~~f~CrCg~~FC~~HR~pe~H~C~fDyk~~gr~~Lak~NP~v~~~ 114 (119)
..+++.++||+.|+++|+|+++|+||||++||++|||+|+|+|+||||++||++|+++||+|+++
T Consensus 19 ~~~k~~~~rC~~C~kkvgl~~~f~CrCg~~FC~~HRy~e~H~C~fDyK~~gr~~iak~NPvV~a~ 83 (85)
T 1wff_A 19 QTKKKIMKHCFLCGKKTGLATSFECRCGNNFCASHRYAEAHGCNYDYKSAGRRYLEEANPVSGPS 83 (85)
T ss_dssp CCCCCCCCBCSSSCCBCSSSSCEECTTCCEECTTTCSTGGGTCCSCCSSSCCCCCCCCCCCCCTT
T ss_pred ccCcccCccchhhCCeecccCCeEcCCCCEecccCCCccCCCCcchhhHHHHHHHHHHCCeecCC
Confidence 34577789999999999996699999999999999999999999999999999999999999986
|
| >1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >1x4w_A Hypothetical protein FLJ13222; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfe_A Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >1x4v_A Hypothetical protein LOC130617; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wys_A Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc binding, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A | Back alignment and structure |
|---|
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A | Back alignment and structure |
|---|
| >1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 | Back alignment and structure |
|---|
| >1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} | Back alignment and structure |
|---|
| >3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* | Back alignment and structure |
|---|
| >3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} | Back alignment and structure |
|---|
| >1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 119 | ||||
| d1wffa_ | 85 | g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog | 2e-20 | |
| d1wfha_ | 64 | g.80.1.1 (A:) Zinc finger A20 and AN1 domains cont | 7e-15 | |
| d1wfla_ | 74 | g.80.1.1 (A:) Zinc finger A20 domain containing pr | 5e-14 | |
| d1wfpa_ | 74 | g.80.1.1 (A:) Zinc finger A20 and AN1 domains cont | 6e-14 | |
| d1wfea_ | 86 | g.80.1.1 (A:) AN1-type zinc finger protein 1 {Mous | 6e-05 |
| >d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
class: Small proteins fold: AN1-like Zinc finger superfamily: AN1-like Zinc finger family: AN1-like Zinc finger domain: ANUBL1 (AN1, ubiquitin-like, homolog) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 76.8 bits (189), Expect = 2e-20
Identities = 24/65 (36%), Positives = 32/65 (49%)
Query: 49 VKKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATN 108
++ K C C K + +SF CRC FC HR+ E H C +DYK+ GR L N
Sbjct: 18 LQTKKKIMKHCFLCGKKTGLATSFECRCGNNFCASHRYAEAHGCNYDYKSAGRRYLEEAN 77
Query: 109 PLVVA 113
P+
Sbjct: 78 PVSGP 82
|
| >d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 | Back information, alignment and structure |
|---|
| >d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 74 | Back information, alignment and structure |
|---|
| >d1wfea_ g.80.1.1 (A:) AN1-type zinc finger protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 119 | |||
| d1wffa_ | 85 | ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus | 99.94 | |
| d1wfla_ | 74 | Zinc finger A20 domain containing protein 2 {Mouse | 99.89 | |
| d1wfpa_ | 74 | Zinc finger A20 and AN1 domains containing protein | 99.89 | |
| d1wfha_ | 64 | Zinc finger A20 and AN1 domains containing protein | 99.89 | |
| d1wfea_ | 86 | AN1-type zinc finger protein 1 {Mouse (Mus musculu | 98.64 | |
| d1wfka_ | 88 | Zinc finger FYVE domain containing protein 19 {Mou | 95.19 | |
| d1vfya_ | 67 | vps27p protein {Baker's yeast (Saccharomyces cerev | 93.55 | |
| d1joca1 | 64 | Eea1 {Human (Homo sapiens) [TaxId: 9606]} | 92.56 | |
| d1dvpa2 | 72 | Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 | 92.47 | |
| d1zbdb_ | 124 | Effector domain of rabphilin-3a {Rat (Rattus norve | 91.48 | |
| d1y02a2 | 51 | Rififylin (FYVE-RING finger protein Sakura) {Human | 89.99 | |
| d1r79a_ | 84 | Diacylglycerol kinase delta {Human (Homo sapiens) | 87.38 | |
| d1tbna_ | 66 | Protein kinase c-gamma {Rat (Rattus rattus) [TaxId | 84.46 | |
| d1z60a1 | 59 | TFIIH p44 subunit cysteine-rich domain {Human (Hom | 80.49 |
| >d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: AN1-like Zinc finger superfamily: AN1-like Zinc finger family: AN1-like Zinc finger domain: ANUBL1 (AN1, ubiquitin-like, homolog) species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.94 E-value=7.1e-29 Score=170.35 Aligned_cols=66 Identities=36% Similarity=0.792 Sum_probs=60.9
Q ss_pred cccCCcCCCcccccccccccccceeeccCCcccCCCCCCCCCCCccccHHhhHHHHHHhCCccccc
Q psy11667 49 VKKTKHKRSRCAQCNAKLTVCSSFTCRCRKLFCPRHRHPEEHACTFDYKAYGRHLLAATNPLVVAD 114 (119)
Q Consensus 49 ~~~~~~~k~RC~~C~kkl~Ls~~f~CrCg~~FC~~HR~pe~H~C~fDyk~~gr~~Lak~NP~v~~~ 114 (119)
...+++.++||++|+++|+|.++|+||||+.||++|||||+|+|+|||++.||++|+++||+|.+.
T Consensus 18 ~~~kk~~~~RC~~C~KKl~l~~~~~CrCg~~FC~~HR~pe~H~CtfDyK~~~k~~L~k~NP~i~p~ 83 (85)
T d1wffa_ 18 LQTKKKIMKHCFLCGKKTGLATSFECRCGNNFCASHRYAEAHGCNYDYKSAGRRYLEEANPVSGPS 83 (85)
T ss_dssp CCCCCCCCCBCSSSCCBCSSSSCEECTTCCEECTTTCSTGGGTCCSCCSSSCCCCCCCCCCCCCTT
T ss_pred cccccccCCcChhcCCeecCCcCeecCCCCEehhhcCCCcCcCCCcchHHHHHHHHHHHCCccCCC
Confidence 455666778999999999997799999999999999999999999999999999999999999874
|
| >d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wfea_ g.80.1.1 (A:) AN1-type zinc finger protein 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|