Diaphorina citri psyllid: psy11674


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
DETTANDHDPLPDFKPIIPLPDEVPVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHKICANHFLHQDMELKPMPNTKQAYIWFAQDYADEVVS
cccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEcccEEEEEEEEEEEEECcccccEEEEEEEccEEEEEEEEEcccccEEECccccccEEEEEEEEccccccc
*******************************************************VGQLKLLKNKDTGKVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHKICANHFLHQDMELKPMPNTKQAYIWFAQDYADEV**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DETTANDHDPLPDFKPIIPLPDEVPVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHKICANHFLHQDMELKPMPNTKQAYIWFAQDYADEVVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ran-specific GTPase-activating protein 1 Stimulates the GTPase activity in the presence of RNA1. May potentiate the action of RanGAP1 (RNA1), thus playing the role of a negative regulator.confidentQ09717
Ran-specific GTPase-activating protein 1 Important for the export of protein containing nuclear export signal (NES) out of the nucleus. Stimulates the GTPase activity of GSP1 and GSP2.confidentP41920
E3 SUMO-protein ligase RanBP2 E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Could also have isomerase or chaperone activity and may bind RNA or DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1.confidentP49792

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007051 [BP]spindle organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0016043, GO:0008150, GO:0000226, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0044615 [CC]nuclear pore nuclear basketprobableGO:0016020, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0031224, GO:0044446, GO:0046930, GO:0016021, GO:0005635, GO:0031967, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0005643, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044428, GO:0044424, GO:0044425, GO:0005634, GO:0044422
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044267 [BP]cellular protein metabolic processprobableGO:0044238, GO:0044260, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0042405 [CC]nuclear inclusion bodyprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0016234, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0006606 [BP]protein import into nucleusprobableGO:0034504, GO:0051169, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0006810, GO:0071702, GO:0016482, GO:0017038, GO:0034613, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0051641, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0008536 [MF]Ran GTPase bindingprobableGO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0005488, GO:0005515
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0046604 [BP]positive regulation of mitotic centrosome separationprobableGO:0033043, GO:0010564, GO:0051128, GO:0032886, GO:0050789, GO:0090068, GO:0007346, GO:0051493, GO:0065007, GO:0048518, GO:0007088, GO:0051130, GO:0050794, GO:0046607, GO:0046605, GO:0046602, GO:0051726, GO:0010638, GO:0051783, GO:0008150, GO:0070507, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K5D, chain B
Confidence level:very confident
Coverage over the Query: 9-50,91-160
View the alignment between query and template
View the model in PyMOL
Template: 1XKE, chain A
Confidence level:very confident
Coverage over the Query: 71-160
View the alignment between query and template
View the model in PyMOL
Template: 1XKE, chain A
Confidence level:very confident
Coverage over the Query: 27-71
View the alignment between query and template
View the model in PyMOL