Psyllid ID: psy11674

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
DETTANDHDPLPDFKPIIPLPDEVPVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHKICANHFLHQDMELKPMPNTKQAYIWFAQDYADEVVS
cccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEcccccEEEEEEEccEEEEEEEEEcccccEEEEccccccEEEEEEEEccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHEEEEEcHHHHHHcccccEEEEEcccccEEEEEEEccHEEEEEEcEEEccccEEccccccccEEEEEEccccccccc
dettandhdplpdfkpiiplpdevpvttgeeneTVLFEQRAKLYRFVDKEwkergvgqlkllknkdtgkvttgeeneTVLFEQRAKLYRFVDKEwkergvgqlkllknkdtgkvRLLMRRDIVHKICANhflhqdmelkpmpntkQAYIWFAQDYADEVVS
dettandhdplpdfkpiiplpDEVPVTTGEENETVLFEQRAKLYRfvdkewkergvgqlkllknkdtgkvttgeenetvlfeqrAKLYrfvdkewkergvgqlkllknkdtgkvrlLMRRDIVHKICANHFlhqdmelkpmPNTKQAYIWFAQDYADEVVS
DETTANDHDPLPDFKPIIPLPDEVPVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHKICANHFLHQDMELKPMPNTKQAYIWFAQDYADEVVS
*******************************NETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHKICANHFLHQDMELKPMPNTKQAYIWFAQDYA*****
**************************************************************************ENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHKICANHFLHQDMELKPMPNTKQAYIWFAQDYADEV**
DETTANDHDPLPDFKPIIPLPDEVPVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHKICANHFLHQDMELKPMPNTKQAYIWFAQDYADEVVS
********DPLPDFKPIIPLP**********************************VGQLKLLKNKDTGKVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHKICANHFLHQDMELKPMPNTKQAYIWFAQDYAD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DETTANDHDPLPDFKPIIPLPDEVPVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHKICANHFLHQDMELKPMPNTKQAYIWFAQDYADEVVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query161 2.2.26 [Sep-21-2011]
Q9ERU9 3053 E3 SUMO-protein ligase Ra yes N/A 0.689 0.036 0.369 2e-23
P49792 3224 E3 SUMO-protein ligase Ra yes N/A 0.583 0.029 0.531 2e-23
P0DJD0 1748 RANBP2-like and GRIP doma no N/A 0.546 0.050 0.521 2e-21
Q99666 1765 RANBP2-like and GRIP doma no N/A 0.552 0.050 0.494 3e-21
O14715 1765 RANBP2-like and GRIP doma no N/A 0.552 0.050 0.494 3e-21
P48820 1085 E3 SUMO-protein ligase Ra no N/A 0.565 0.083 0.505 4e-21
Q7Z3J3 1758 RanBP2-like and GRIP doma no N/A 0.565 0.051 0.505 1e-20
P0DJD1 1756 RANBP2-like and GRIP doma no N/A 0.552 0.050 0.505 2e-20
A6NKT7 1758 RanBP2-like and GRIP doma no N/A 0.565 0.051 0.505 3e-20
P43487201 Ran-specific GTPase-activ no N/A 0.559 0.447 0.515 3e-20
>sp|Q9ERU9|RBP2_MOUSE E3 SUMO-protein ligase RanBP2 OS=Mus musculus GN=Ranbp2 PE=1 SV=2 Back     alignment and function desciption
 Score =  108 bits (270), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 58/157 (36%), Positives = 85/157 (54%), Gaps = 46/157 (29%)

Query: 5    ANDHDPLPDFKPIIPLPDEVPVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKN 64
             ++ D  P F+P++PLPD++                                        
Sbjct: 1157 GDEEDDGPHFEPVVPLPDKI---------------------------------------- 1176

Query: 65   KDTGKVTTGEENETVLFEQRAKLYRF--VDKEWKERGVGQLKLLKNKDTGKVRLLMRRDI 122
                +V TGEE+E   F  RAKL+RF    KEWKERG+G +K+L++K +GK+RLLMRR+ 
Sbjct: 1177 ----EVKTGEEDEEEFFCNRAKLFRFDGESKEWKERGIGNVKILRHKTSGKIRLLMRREQ 1232

Query: 123  VHKICANHFLHQDMELKPMPNTKQAYIWFAQDYADEV 159
            V KICANH++  DM+L P   + ++++W A DYADE+
Sbjct: 1233 VLKICANHYISPDMKLTPNAGSDRSFVWHALDYADEL 1269
E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Could also have isomerase or chaperone activity and may bind RNA or DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1.
Mus musculus (taxid: 10090)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|P49792|RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 Back     alignment and function description
>sp|P0DJD0|RGPD1_HUMAN RANBP2-like and GRIP domain-containing protein 1 OS=Homo sapiens GN=RGPD1 PE=2 SV=1 Back     alignment and function description
>sp|Q99666|RGPD5_HUMAN RANBP2-like and GRIP domain-containing protein 5/6 OS=Homo sapiens GN=RGPD5 PE=1 SV=3 Back     alignment and function description
>sp|O14715|RGPD8_HUMAN RANBP2-like and GRIP domain-containing protein 8 OS=Homo sapiens GN=RGPD8 PE=1 SV=2 Back     alignment and function description
>sp|P48820|RBP2_BOVIN E3 SUMO-protein ligase RanBP2 (Fragment) OS=Bos taurus GN=RANBP2 PE=2 SV=2 Back     alignment and function description
>sp|Q7Z3J3|RGPD4_HUMAN RanBP2-like and GRIP domain-containing protein 4 OS=Homo sapiens GN=RGPD4 PE=2 SV=3 Back     alignment and function description
>sp|P0DJD1|RGPD2_HUMAN RANBP2-like and GRIP domain-containing protein 2 OS=Homo sapiens GN=RGPD2 PE=2 SV=1 Back     alignment and function description
>sp|A6NKT7|RGPD3_HUMAN RanBP2-like and GRIP domain-containing protein 3 OS=Homo sapiens GN=RGPD3 PE=2 SV=2 Back     alignment and function description
>sp|P43487|RANG_HUMAN Ran-specific GTPase-activating protein OS=Homo sapiens GN=RANBP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
357605898 2799 putative ran-binding protein [Danaus ple 0.708 0.040 0.481 6e-35
91079160 2779 PREDICTED: similar to ran-binding protei 0.708 0.041 0.481 5e-33
156546701 2907 PREDICTED: hypothetical protein LOC10012 0.695 0.038 0.496 1e-32
322782969 2855 hypothetical protein SINV_12257 [Solenop 0.708 0.039 0.471 3e-30
307172622 2907 E3 SUMO-protein ligase RanBP2 [Camponotu 0.708 0.039 0.471 4e-30
328717652 2308 PREDICTED: e3 SUMO-protein ligase RanBP2 0.701 0.048 0.446 2e-29
240991855 2674 ran-binding protein (RanBP), putative [I 0.621 0.037 0.489 7e-29
307201149 2969 E3 SUMO-protein ligase RanBP2 [Harpegnat 0.677 0.036 0.480 8e-29
350408484 2846 PREDICTED: hypothetical protein LOC10074 0.683 0.038 0.458 2e-28
328786667 2830 PREDICTED: LOW QUALITY PROTEIN: e3 SUMO- 0.683 0.038 0.445 6e-28
>gi|357605898|gb|EHJ64822.1| putative ran-binding protein [Danaus plexippus] Back     alignment and taxonomy information
 Score =  152 bits (383), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 96/158 (60%), Gaps = 44/158 (27%)

Query: 3    TTANDHDPLPDFKPIIPLPDEVPVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLL 62
            T+  ++DP PDFKPIIPLP EV                                      
Sbjct: 1218 TSVENYDPCPDFKPIIPLPAEV-------------------------------------- 1239

Query: 63   KNKDTGKVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDI 122
                  KVTTGEE+E+V+F  RAKL+RFVDK+WKERG+G++KLLK+K TGKVR+LMRR+ 
Sbjct: 1240 ------KVTTGEEDESVIFSARAKLFRFVDKQWKERGIGEMKLLKHKVTGKVRVLMRREQ 1293

Query: 123  VHKICANHFLHQDMELKPMPNTKQAYIWFAQDYADEVV 160
            VHKICANH +  +ME+KPM N  +AY W A D+A+E V
Sbjct: 1294 VHKICANHIILPEMEIKPMKNETKAYFWVANDFAEETV 1331

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91079160|ref|XP_967064.1| PREDICTED: similar to ran-binding protein [Tribolium castaneum] gi|270003619|gb|EFA00067.1| hypothetical protein TcasGA2_TC002881 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|156546701|ref|XP_001604378.1| PREDICTED: hypothetical protein LOC100120774 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|322782969|gb|EFZ10687.1| hypothetical protein SINV_12257 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307172622|gb|EFN63981.1| E3 SUMO-protein ligase RanBP2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328717652|ref|XP_001952671.2| PREDICTED: e3 SUMO-protein ligase RanBP2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|240991855|ref|XP_002404439.1| ran-binding protein (RanBP), putative [Ixodes scapularis] gi|215491566|gb|EEC01207.1| ran-binding protein (RanBP), putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|307201149|gb|EFN81060.1| E3 SUMO-protein ligase RanBP2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350408484|ref|XP_003488418.1| PREDICTED: hypothetical protein LOC100740739 [Bombus impatiens] Back     alignment and taxonomy information
>gi|328786667|ref|XP_001122024.2| PREDICTED: LOW QUALITY PROTEIN: e3 SUMO-protein ligase RanBP2 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
FB|FBgn0039302 2695 Nup358 "Nucleoporin 358kD" [Dr 0.596 0.035 0.5 1e-19
UNIPROTKB|F1PA81 3047 F1PA81 "Uncharacterized protei 0.583 0.030 0.541 1.1e-21
UNIPROTKB|P49792 3224 RANBP2 "E3 SUMO-protein ligase 0.583 0.029 0.541 1.2e-21
UNIPROTKB|F1MXS1 3035 RANBP2 "Putative peptidyl-prol 0.577 0.030 0.536 5.4e-22
MGI|MGI:894323 3053 Ranbp2 "RAN binding protein 2" 0.583 0.030 0.531 1.5e-21
RGD|1560047 3055 Ranbp2 "RAN binding protein 2" 0.583 0.030 0.531 1.5e-21
UNIPROTKB|F1SU29 2808 RANBP2 "Uncharacterized protei 0.546 0.031 0.521 1.1e-36
UNIPROTKB|E9PGT0 2248 RANBP2 "Putative peptidyl-prol 0.546 0.039 0.521 3.1e-20
UNIPROTKB|P48820 1085 RANBP2 "E3 SUMO-protein ligase 0.565 0.083 0.505 6.8e-20
UNIPROTKB|A6NKT7 1758 RGPD3 "RanBP2-like and GRIP do 0.565 0.051 0.505 2e-34
FB|FBgn0039302 Nup358 "Nucleoporin 358kD" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 252 (93.8 bits), Expect = 1.0e-19, P = 1.0e-19
 Identities = 49/98 (50%), Positives = 66/98 (67%)

Query:    66 DTGKVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHK 125
             D  +V TGEE E + F  RAKL+R+VDKEWKERG G +K+L +K TG  R+LMRRD  HK
Sbjct:  1318 DEVEVRTGEEGEDIKFTSRAKLFRYVDKEWKERGTGVIKILCDKATGVSRVLMRRDQTHK 1377

Query:   126 ICANHFLHQDMELKP--MPNTKQAYIWFAQDYADEVVS 161
             +CANH +  D+ +        K++ +W A D+ADE V+
Sbjct:  1378 VCANHTITADITINVANQDKDKKSLLWAANDFADEQVT 1415
GO:0008536 "Ran GTPase binding" evidence=ISS
GO:0005643 "nuclear pore" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0006607 "NLS-bearing substrate import into nucleus" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0007184 "SMAD protein import into nucleus" evidence=IMP
GO:0006606 "protein import into nucleus" evidence=IMP
UNIPROTKB|F1PA81 F1PA81 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P49792 RANBP2 "E3 SUMO-protein ligase RanBP2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MXS1 RANBP2 "Putative peptidyl-prolyl cis-trans isomerase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:894323 Ranbp2 "RAN binding protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1560047 Ranbp2 "RAN binding protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SU29 RANBP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E9PGT0 RANBP2 "Putative peptidyl-prolyl cis-trans isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P48820 RANBP2 "E3 SUMO-protein ligase RanBP2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A6NKT7 RGPD3 "RanBP2-like and GRIP domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P49792RBP2_HUMAN5, ., 2, ., 1, ., 80.53120.58380.0291yesN/A
Q09717RANG_SCHPONo assigned EC number0.51380.43470.3255yesN/A
P41920YRB1_YEASTNo assigned EC number0.54210.50310.4029yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
cd13171112 cd13171, RanBD1_RanBP2_insect-like, Ran-binding pr 5e-44
cd13176116 cd13176, RanBD1_RanBD3_RanBP2_mammal-like, Ran-bin 2e-40
cd00835111 cd00835, RanBD_family, Ran-binding domain 2e-38
cd13179126 cd13179, RanBD_RanBP1, Ran-binding domain 3e-37
smart00160130 smart00160, RanBD, Ran-binding domain 6e-36
pfam00638122 pfam00638, Ran_BP1, RanBP1 domain 7e-35
cd13172113 cd13172, RanBD2_RanBP2_insect-like, Ran-binding pr 6e-32
cd13173110 cd13173, RanBD3_RanBP2_insect-like, Ran-binding pr 1e-28
cd13177117 cd13177, RanBD2_RanBP2_mammal-like, Ran-binding pr 2e-28
cd13178117 cd13178, RanBD4_RanBP2_mammal-like, Ran-binding pr 2e-26
cd13174113 cd13174, RanBD4_RanBP2_insect-like, Ran-binding pr 4e-25
COG5171211 COG5171, YRB1, Ran GTPase-activating protein (Ran- 9e-21
cd13181111 cd13181, RanBD_NUP2, Nucleoporin 2 Ran-binding dom 1e-12
cd13170109 cd13170, RanBD_NUP50, Nucleoporin 50 Ran-binding d 2e-12
cd13175106 cd13175, RanBD5_RanBP2_insect-like, Ran-binding pr 5e-12
cd13175106 cd13175, RanBD5_RanBP2_insect-like, Ran-binding pr 2e-09
cd13169112 cd13169, RanBD_NUP50_plant, Ran-binding protein 2, 8e-09
cd13181111 cd13181, RanBD_NUP2, Nucleoporin 2 Ran-binding dom 5e-08
cd13170109 cd13170, RanBD_NUP50, Nucleoporin 50 Ran-binding d 8e-08
cd13169112 cd13169, RanBD_NUP50_plant, Ran-binding protein 2, 8e-04
>gnl|CDD|241325 cd13171, RanBD1_RanBP2_insect-like, Ran-binding protein 2, Ran binding domain repeat 1 Back     alignment and domain information 
 Score =  140 bits (355), Expect = 5e-44
 Identities = 59/84 (70%), Positives = 69/84 (82%)

Query: 77  ETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHKICANHFLHQDM 136
           E VLF  RAKL+R+VDKEWKERG+G LK+LKN  TGKVRLLMRR+ VHK+CANHF+ +DM
Sbjct: 1   EEVLFCARAKLFRYVDKEWKERGIGNLKILKNPATGKVRLLMRREQVHKVCANHFITKDM 60

Query: 137 ELKPMPNTKQAYIWFAQDYADEVV 160
           EL PM    +AYIW A D+ADEVV
Sbjct: 61  ELTPMDKEDKAYIWAANDFADEVV 84

RanBP2 (also called E3 SUMO-protein ligase RanBP2, 358 kDa nucleoporin, and nuclear pore complex (NPC) protein Nup358) is a giant nucleoporin that localizes to the cytosolic face of the NPC. RanBP2 contains a leucine-rich region, 8 zinc-finger motifs, a cyclophilin A homologous domain, and 4 RanBDs. Ran is a Ras-like nuclear small GTPase, which regulates receptor-mediated transport between the nucleus and the cytoplasm. RanGTP hydrolysis is stimulated by RanGAP together with the Ran-binding domain containing acessory proteins RanBP1 and RanBP2. These accessory proteins stabilize the active GTP-bound form of Ran. All eukaryotic cells contain RanBP1, but in vertebrates however, the main RanBP seems to be RanBP2. There is no RanBP2 ortholog in yeast. Transport complex disassembly is accomplished by a small ubiquitin-related modifier-1 (SUMO-1)-modified version of RanGAP that is bound to RanBP2. RanBP1 acts as a second line of defense against exported RanGTP-importin complexes which have escaped from dissociation by RanBP2. RanBP2 also interacts with the importin subunit beta-1. RabBD shares structural similarity to the PH domain, but lacks detectable sequence similarity. The members here include insects and nematodes. The first RanBD is present in this hierarchy. Length = 112
>gnl|CDD|241330 cd13176, RanBD1_RanBD3_RanBP2_mammal-like, Ran-binding protein 2, Ran binding domain repeats 1 and 3 Back     alignment and domain information
>gnl|CDD|241232 cd00835, RanBD_family, Ran-binding domain Back     alignment and domain information
>gnl|CDD|241333 cd13179, RanBD_RanBP1, Ran-binding domain Back     alignment and domain information
>gnl|CDD|197549 smart00160, RanBD, Ran-binding domain Back     alignment and domain information
>gnl|CDD|109686 pfam00638, Ran_BP1, RanBP1 domain Back     alignment and domain information
>gnl|CDD|241326 cd13172, RanBD2_RanBP2_insect-like, Ran-binding protein 2, Ran binding domain repeat 2 Back     alignment and domain information
>gnl|CDD|241327 cd13173, RanBD3_RanBP2_insect-like, Ran-binding protein 2, Ran binding domain repeat 3 Back     alignment and domain information
>gnl|CDD|241331 cd13177, RanBD2_RanBP2_mammal-like, Ran-binding protein 2, Ran binding domain repeats 2 Back     alignment and domain information
>gnl|CDD|241332 cd13178, RanBD4_RanBP2_mammal-like, Ran-binding protein 2, Ran binding domain repeats 2 and 4 Back     alignment and domain information
>gnl|CDD|241328 cd13174, RanBD4_RanBP2_insect-like, Ran-binding protein 2, Ran binding domain repeat 4 Back     alignment and domain information
>gnl|CDD|227499 COG5171, YRB1, Ran GTPase-activating protein (Ran-binding protein) [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|241335 cd13181, RanBD_NUP2, Nucleoporin 2 Ran-binding domain Back     alignment and domain information
>gnl|CDD|241324 cd13170, RanBD_NUP50, Nucleoporin 50 Ran-binding domain Back     alignment and domain information
>gnl|CDD|241329 cd13175, RanBD5_RanBP2_insect-like, Ran-binding protein 2, Ran binding domain repeat 5 Back     alignment and domain information
>gnl|CDD|241329 cd13175, RanBD5_RanBP2_insect-like, Ran-binding protein 2, Ran binding domain repeat 5 Back     alignment and domain information
>gnl|CDD|241323 cd13169, RanBD_NUP50_plant, Ran-binding protein 2, repeat 1 Back     alignment and domain information
>gnl|CDD|241335 cd13181, RanBD_NUP2, Nucleoporin 2 Ran-binding domain Back     alignment and domain information
>gnl|CDD|241324 cd13170, RanBD_NUP50, Nucleoporin 50 Ran-binding domain Back     alignment and domain information
>gnl|CDD|241323 cd13169, RanBD_NUP50_plant, Ran-binding protein 2, repeat 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 161
smart00160130 RanBD Ran-binding domain. Domain of apporximately 100.0
COG5171211 YRB1 Ran GTPase-activating protein (Ran-binding pr 100.0
cd00835122 RanBD Ran-binding domain. Ran-binding domain; This 100.0
PF00638122 Ran_BP1: RanBP1 domain; InterPro: IPR000156 Ran is 99.97
KOG0864|consensus215 99.85
cd00835122 RanBD Ran-binding domain. Ran-binding domain; This 99.55
KOG2724|consensus487 98.88
KOG0866|consensus327 98.86
cd00837104 EVH1 EVH1 (Enabled, Vasp-Homology) or WASP Homolog 98.77
KOG0866|consensus327 98.47
smart00160130 RanBD Ran-binding domain. Domain of apporximately 98.05
PF00638122 Ran_BP1: RanBP1 domain; InterPro: IPR000156 Ran is 97.93
cd01207111 Ena-Vasp Enabled-VASP-type homology (EVH1) domain. 97.8
cd01206111 Homer Homer type EVH1 domain. Homer type EVH1 doma 97.7
PF00568111 WH1: WH1 domain; InterPro: IPR000697 The EVH1 (WH1 97.68
COG5171211 YRB1 Ran GTPase-activating protein (Ran-binding pr 97.03
smart00461106 WH1 WASP homology region 1. Region of the Wiskott- 94.49
cd00837104 EVH1 EVH1 (Enabled, Vasp-Homology) or WASP Homolog 87.96
KOG2724|consensus487 87.92
>smart00160 RanBD Ran-binding domain Back     alignment and domain information 
Probab=100.00  E-value=5.4e-36  Score=226.75  Aligned_cols=104  Identities=58%  Similarity=1.061  Sum_probs=97.7

Q ss_pred             ccccccCCCccccccccccceeeeeeeceeeeeeccceeeecccceeeecccCCCccccCCCcceeeEEeeeeEeeeecc
Q psy11674         14 FKPIIPLPDEVPVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVTTGEENETVLFEQRAKLYRFVDK   93 (161)
Q Consensus        14 f~pv~~l~~~v~v~tgEE~E~~~f~~r~kl~~~~~~~wkerGvg~~kl~~~~~t~~i~tGEE~E~~lf~~raKL~~~~~~   93 (161)
                      |+|+++|| .|+++||||+|+++|+.|||||+|++.                                          ++
T Consensus         1 ~~~~~~l~-~ve~~tgEE~E~~lf~~r~KL~~~~~~------------------------------------------~~   37 (130)
T smart00160        1 FKPVVPLP-DVEVKTGEEDEEVIFSARAKLYRFAND------------------------------------------KK   37 (130)
T ss_pred             CCCcccCc-cccccCCCcCeEEEEEEEeEEEEEcCC------------------------------------------CC
Confidence            89999999 599999999999999999999999853                                          36


Q ss_pred             ceeeeccceeeeeecCCC-CcEEEEEEeCCeeeEEEcccccCCcEEeecCCCCcEEEEEeeecCCCCC
Q psy11674         94 EWKERGVGQLKLLKNKDT-GKVRLLMRRDIVHKICANHFLHQDMELKPMPNTKQAYIWFAQDYADEVV  160 (161)
Q Consensus        94 ~WkerGvG~lkil~~~~t-~~~RilmR~d~~~kv~lN~~I~~~m~~~~~~~~~~a~~w~a~D~sd~~~  160 (161)
                      +|++||+|.||||+++++ +++|||||++++++|+|||+|+++|+++++.++.++|+|++.|++|+++
T Consensus        38 ~WkerG~G~lki~~~~~~~~~~RivmR~~~~~kv~lN~~i~~~~~~~~~~~~~~~~~~~~~d~~d~~~  105 (130)
T smart00160       38 EWKERGVGDLKILKSKDNGGKVRIVMRRDGVLKVCANHPIFKSMTLKPLAGSNRALKWTPEDFADDIP  105 (130)
T ss_pred             CCeeccEEEEEEEEcCCCCCeEEEEEEECCCceEEeccEecCCcEEeecCCCcceEEEeeeecCCCCC
Confidence            899999999999999999 8999999999999999999999999999999999999999999999864

Domain of apporximately 150 residues that stabilises the GTP-bound form of Ran (the Ras-like nuclear small GTPase).
>COG5171 YRB1 Ran GTPase-activating protein (Ran-binding protein) [Intracellular trafficking and secretion] Back     alignment and domain information
>cd00835 RanBD Ran-binding domain Back     alignment and domain information
>PF00638 Ran_BP1: RanBP1 domain; InterPro: IPR000156 Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm Back     alignment and domain information
>KOG0864|consensus Back     alignment and domain information
>cd00835 RanBD Ran-binding domain Back     alignment and domain information
>KOG2724|consensus Back     alignment and domain information
>KOG0866|consensus Back     alignment and domain information
>cd00837 EVH1 EVH1 (Enabled, Vasp-Homology) or WASP Homology (WH1) domain Back     alignment and domain information
>KOG0866|consensus Back     alignment and domain information
>smart00160 RanBD Ran-binding domain Back     alignment and domain information
>PF00638 Ran_BP1: RanBP1 domain; InterPro: IPR000156 Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm Back     alignment and domain information
>cd01207 Ena-Vasp Enabled-VASP-type homology (EVH1) domain Back     alignment and domain information
>cd01206 Homer Homer type EVH1 domain Back     alignment and domain information
>PF00568 WH1: WH1 domain; InterPro: IPR000697 The EVH1 (WH1, RanBP1-WASP) domain is found in multi-domain proteins implicated in a diverse range of signalling, nuclear transport and cytoskeletal events Back     alignment and domain information
>COG5171 YRB1 Ran GTPase-activating protein (Ran-binding protein) [Intracellular trafficking and secretion] Back     alignment and domain information
>smart00461 WH1 WASP homology region 1 Back     alignment and domain information
>cd00837 EVH1 EVH1 (Enabled, Vasp-Homology) or WASP Homology (WH1) domain Back     alignment and domain information
>KOG2724|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
1rrp_B134 Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 9e-25
1xke_A130 Solution Structure Of The Second Ran-Binding Domain 1e-22
1k5d_B201 Crystal Structure Of Ran-Gppnhp-Ranbp1-Rangap Compl 3e-21
4gpt_B140 Crystal Structure Of Kpt251 In Complex With Crm1-ra 2e-18
3m1i_B191 Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex 3e-18
4gmx_B141 Crystal Structure Of Kpt185 In Complex With Crm1-Ra 5e-18
4hat_B140 Crystal Structure Of Crm1 Inhibitor Leptomycin B In 6e-18
3n7c_A130 Crystal Structure Of The Ran Binding Domain From Th 9e-08
3oan_A130 Crystal Structure Of The Ran Binding Domain From Th 1e-07
>pdb|1RRP|B Chain B, Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 134 Back     alignment and structure 
Iteration: 1

 Score =  109 bits (272), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 71/96 (73%), Gaps = 2/96 (2%)
Query: 66  DTGKVTTGEENETVLFEQRAKLYRF--VDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIV 123
           D  +V TGEE+E   F  RAKL+RF    KEWKERG+G +K+L++K +GK+RLLMRR+ V
Sbjct: 10  DKIEVKTGEEDEEEFFCNRAKLFRFDVESKEWKERGIGNVKILRHKTSGKIRLLMRREQV 69
Query: 124 HKICANHFLHQDMELKPMPNTKQAYIWFAQDYADEV 159
            KICANH++  DM+L P   + ++++W A DYADE+
Sbjct: 70  LKICANHYISPDMKLTPNAGSDRSFVWHALDYADEL 105
>pdb|1XKE|A Chain A, Solution Structure Of The Second Ran-Binding Domain From Human Ranbp2 Length = 130 Back     alignment and structure
>pdb|1K5D|B Chain B, Crystal Structure Of Ran-Gppnhp-Ranbp1-Rangap Complex Length = 201 Back     alignment and structure
>pdb|4GPT|B Chain B, Crystal Structure Of Kpt251 In Complex With Crm1-ran-ranbp1 Length = 140 Back     alignment and structure
>pdb|3M1I|B Chain B, Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex With Yeas (Yrb1p) And Yeast Rangtp (Gsp1pgtp) Length = 191 Back     alignment and structure
>pdb|4GMX|B Chain B, Crystal Structure Of Kpt185 In Complex With Crm1-Ran-Ranbp1 Length = 141 Back     alignment and structure
>pdb|4HAT|B Chain B, Crystal Structure Of Crm1 Inhibitor Leptomycin B In Complex With Crm1- Ran-ranbp1 Length = 140 Back     alignment and structure
>pdb|3N7C|A Chain A, Crystal Structure Of The Ran Binding Domain From The Nuclear Complex Component Nup2 From Ashbya Gossypii Length = 130 Back     alignment and structure
>pdb|3OAN|A Chain A, Crystal Structure Of The Ran Binding Domain From The Nuclear Complex Component Nup2 From Ashbya Gossypii Length = 130 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
2ec1_A125 Nucleoporin 50 kDa; ranbp domain, nuclear pore-ass 6e-30
1rrp_B134 Nuclear pore complex protein NUP358; complex (smal 3e-28
1xke_A130 RAN-binding protein 2; beta barrel, pleckstrin-hom 5e-28
3n7c_A130 ABR034WP; nuclear pore complex, NUP2, RAN-binding 1e-25
1k5d_B201 RAN-specific GTPase-activating protein; ranbp1, ra 1e-24
2y8g_A138 Ranbp3-B, RAN-binding protein 3; protein transport 2e-24
3m1i_B191 RAN-specific GTPase-activating protein 1; heat rep 5e-24
2crf_A150 RAN binding protein 3; RAN_BP1 domain, ranbp3, str 3e-23
>2ec1_A Nucleoporin 50 kDa; ranbp domain, nuclear pore-associated protein 60 kDa-like, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 125 Back     alignment and structure
 Score =  104 bits (261), Expect = 6e-30
 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 3/91 (3%)

Query: 70  VTTGE-ENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRD-IVHKIC 127
            ++GE + E   + ++ KL+   D E+KE+G+G L  LK     K +LL+R D  +  I 
Sbjct: 4   GSSGEVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLH-LKPTANQKTQLLVRADTNLGNIL 62

Query: 128 ANHFLHQDMELKPMPNTKQAYIWFAQDYADE 158
            N  +  +M            +       DE
Sbjct: 63  LNVLIPPNMPCTRTGKNNVLIVCVPNPPIDE 93
>1rrp_B Nuclear pore complex protein NUP358; complex (small GTPase/nuclear protein), small GTPase, nuclear transport; HET: GNP; 2.96A {Homo sapiens} SCOP: b.55.1.3 Length = 134 Back     alignment and structure
>1xke_A RAN-binding protein 2; beta barrel, pleckstrin-homology (PH) domain, phosphotyrosine-binding (PTB) domain, protein transport; NMR {Homo sapiens} SCOP: b.55.1.3 Length = 130 Back     alignment and structure
>3n7c_A ABR034WP; nuclear pore complex, NUP2, RAN-binding domain, nucleoporin, structural genomics, PSI-2, protein structure initiative; 2.26A {Ashbya gossypii} PDB: 3oan_A Length = 130 Back     alignment and structure
>1k5d_B RAN-specific GTPase-activating protein; ranbp1, rangap, GAP, signal transduction, nuclear transport, GTP hydrolysis, ground state; HET: GNP; 2.70A {Homo sapiens} SCOP: b.55.1.3 PDB: 1k5g_B* Length = 201 Back     alignment and structure
>2y8g_A Ranbp3-B, RAN-binding protein 3; protein transport, CRM1-mediated nuclear export; 1.61A {Homo sapiens} PDB: 2y8f_A Length = 138 Back     alignment and structure
>3m1i_B RAN-specific GTPase-activating protein 1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} Length = 191 Back     alignment and structure
>2crf_A RAN binding protein 3; RAN_BP1 domain, ranbp3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.3 Length = 150 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
3m1i_B191 RAN-specific GTPase-activating protein 1; heat rep 100.0
4hat_B140 RAN-specific GTPase-activating protein 1; heat rep 100.0
1rrp_B134 Nuclear pore complex protein NUP358; complex (smal 100.0
1k5d_B201 RAN-specific GTPase-activating protein; ranbp1, ra 100.0
1xke_A130 RAN-binding protein 2; beta barrel, pleckstrin-hom 100.0
2crf_A150 RAN binding protein 3; RAN_BP1 domain, ranbp3, str 100.0
2y8g_A138 Ranbp3-B, RAN-binding protein 3; protein transport 100.0
3n7c_A130 ABR034WP; nuclear pore complex, NUP2, RAN-binding 99.97
2ec1_A125 Nucleoporin 50 kDa; ranbp domain, nuclear pore-ass 99.97
1xke_A130 RAN-binding protein 2; beta barrel, pleckstrin-hom 99.48
2ec1_A125 Nucleoporin 50 kDa; ranbp domain, nuclear pore-ass 99.46
1qc6_A130 EVH1 domain from ENA/VAsp-like protein; AN incompl 99.18
1ddw_A120 GLGF-domain protein homer; pleckstrin homology dom 98.7
1i2h_A168 PSD-ZIP45(homer-1C/VESL-1L); enabled VAsp homology 98.54
1rrp_B134 Nuclear pore complex protein NUP358; complex (smal 98.22
3n7c_A130 ABR034WP; nuclear pore complex, NUP2, RAN-binding 98.12
4hat_B140 RAN-specific GTPase-activating protein 1; heat rep 98.11
1evh_A112 WH1 domain, protein (MENA EVH1 domain); molecular 98.09
1k5d_B201 RAN-specific GTPase-activating protein; ranbp1, ra 98.05
3m1i_B191 RAN-specific GTPase-activating protein 1; heat rep 98.04
1egx_A115 VAsp, vasodilator-stimulated phosphoprotein; EVH1, 98.04
2crf_A150 RAN binding protein 3; RAN_BP1 domain, ranbp3, str 98.02
2y8g_A138 Ranbp3-B, RAN-binding protein 3; protein transport 97.97
1xod_A118 Spred1; sprouty, EVH1, peptide-binding, signaling 97.67
2jp2_A126 Spred-2, sprouty-related, EVH1 domain-containing p 97.49
3syx_A130 Sprouty-related, EVH1 domain-containing protein 1; 96.13
1qc6_A130 EVH1 domain from ENA/VAsp-like protein; AN incompl 95.62
1ddw_A120 GLGF-domain protein homer; pleckstrin homology dom 92.12
1i2h_A168 PSD-ZIP45(homer-1C/VESL-1L); enabled VAsp homology 88.94
1mke_A152 WIP - N-WAsp, fusion protein consisting of wiskott 82.07
>3m1i_B RAN-specific GTPase-activating protein 1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=3.1e-42  Score=274.46  Aligned_cols=116  Identities=45%  Similarity=0.735  Sum_probs=92.5

Q ss_pred             CCcCCCCCCCCCccccccCCCccccccccccceeeeeeeceeeeeeccceeeecccceeeecccCCCccccCCCcceeeE
Q psy11674          2 ETTANDHDPLPDFKPIIPLPDEVPVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVTTGEENETVLF   81 (161)
Q Consensus         2 ~~~~~~~~~~~~f~pv~~l~~~v~v~tgEE~E~~~f~~r~kl~~~~~~~wkerGvg~~kl~~~~~t~~i~tGEE~E~~lf   81 (161)
                      ++.+++++|++||+|||+|+ +|+|+||||+|+++|+.|||||+|+..                                
T Consensus        43 ~~~~~ee~~~~~f~Pvv~L~-~vev~tGEEdEe~lf~~RaKLf~f~~~--------------------------------   89 (191)
T 3m1i_B           43 EGDDAPESPDIHFEPVVHLE-KVDVKTMEEDEEVLYKVRAKLFRFDAD--------------------------------   89 (191)
T ss_dssp             ------------------CC-CCCCCCSCTTEEEEEEEEEEEEEEETT--------------------------------
T ss_pred             cccccccCCCCCcccceecc-cccccCCCcceeeeeEEeeEEEEEecC--------------------------------
Confidence            45667899999999999995 899999999999999999999999852                                


Q ss_pred             EeeeeEeeeeccceeeeccceeeeeecCCCCcEEEEEEeCCeeeEEEcccccCCcEEeecCCCCcEEEEEe-eecCCCCC
Q psy11674         82 EQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHKICANHFLHQDMELKPMPNTKQAYIWFA-QDYADEVV  160 (161)
Q Consensus        82 ~~raKL~~~~~~~WkerGvG~lkil~~~~t~~~RilmR~d~~~kv~lN~~I~~~m~~~~~~~~~~a~~w~a-~D~sd~~~  160 (161)
                                +++|++||+|.||||+|++++++|||||+|+++||||||+|+++|+++++.+++++|+|++ .|||||+|
T Consensus        90 ----------~~~WKERGvG~lkilk~ket~k~RllMR~d~~~kV~LN~~I~~~m~~~~~~~sdks~v~~~~~D~sdge~  159 (191)
T 3m1i_B           90 ----------AKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEA  159 (191)
T ss_dssp             ----------TTEEEEEEEEEEEEEEETTTCCEEEEEECTTTCCEEEEEECCTTCCCBCCTTCSSEEEEEEEEECTTSSC
T ss_pred             ----------CCCccceeEEEEEEEEcCCCCeEEEEEEecCcceEEEeeecCCCcEEeECCCCCceEEEEecCcCCCCCc
Confidence                      3578899999999999999999999999999999999999999999999999999999997 89999985
>4hat_B RAN-specific GTPase-activating protein 1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_B* 4hav_B* 4haw_B* 4hax_B* 4hay_B* 4haz_B* 4hb0_B* 4hb2_B* 4hb3_B* 4hb4_B* 4gmx_B* 4gpt_B* Back     alignment and structure
>1rrp_B Nuclear pore complex protein NUP358; complex (small GTPase/nuclear protein), small GTPase, nuclear transport; HET: GNP; 2.96A {Homo sapiens} SCOP: b.55.1.3 Back     alignment and structure
>1k5d_B RAN-specific GTPase-activating protein; ranbp1, rangap, GAP, signal transduction, nuclear transport, GTP hydrolysis, ground state; HET: GNP; 2.70A {Homo sapiens} SCOP: b.55.1.3 PDB: 1k5g_B* Back     alignment and structure
>1xke_A RAN-binding protein 2; beta barrel, pleckstrin-homology (PH) domain, phosphotyrosine-binding (PTB) domain, protein transport; NMR {Homo sapiens} SCOP: b.55.1.3 Back     alignment and structure
>2crf_A RAN binding protein 3; RAN_BP1 domain, ranbp3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.3 Back     alignment and structure
>2y8g_A Ranbp3-B, RAN-binding protein 3; protein transport, CRM1-mediated nuclear export; 1.61A {Homo sapiens} PDB: 2y8f_A Back     alignment and structure
>3n7c_A ABR034WP; nuclear pore complex, NUP2, RAN-binding domain, nucleoporin, structural genomics, PSI-2, protein structure initiative; 2.26A {Ashbya gossypii} PDB: 3oan_A Back     alignment and structure
>2ec1_A Nucleoporin 50 kDa; ranbp domain, nuclear pore-associated protein 60 kDa-like, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1xke_A RAN-binding protein 2; beta barrel, pleckstrin-homology (PH) domain, phosphotyrosine-binding (PTB) domain, protein transport; NMR {Homo sapiens} SCOP: b.55.1.3 Back     alignment and structure
>2ec1_A Nucleoporin 50 kDa; ranbp domain, nuclear pore-associated protein 60 kDa-like, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qc6_A EVH1 domain from ENA/VAsp-like protein; AN incomplete seven stranded anti-parallel beta barrel closed by AN alpha helix, EVH1 domain; 2.60A {Mus musculus} SCOP: b.55.1.4 Back     alignment and structure
>1ddw_A GLGF-domain protein homer; pleckstrin homology domain fold, signaling protein; 1.70A {Rattus norvegicus} SCOP: b.55.1.4 PDB: 1ddv_A 2p8v_A 1i7a_A* Back     alignment and structure
>1i2h_A PSD-ZIP45(homer-1C/VESL-1L); enabled VAsp homology 1 domain, signaling protein; 1.80A {Rattus norvegicus} SCOP: b.55.1.4 Back     alignment and structure
>1rrp_B Nuclear pore complex protein NUP358; complex (small GTPase/nuclear protein), small GTPase, nuclear transport; HET: GNP; 2.96A {Homo sapiens} SCOP: b.55.1.3 Back     alignment and structure
>3n7c_A ABR034WP; nuclear pore complex, NUP2, RAN-binding domain, nucleoporin, structural genomics, PSI-2, protein structure initiative; 2.26A {Ashbya gossypii} PDB: 3oan_A Back     alignment and structure
>4hat_B RAN-specific GTPase-activating protein 1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_B* 4hav_B* 4haw_B* 4hax_B* 4hay_B* 4haz_B* 4hb0_B* 4hb2_B* 4hb3_B* 4hb4_B* 4gmx_B* 4gpt_B* Back     alignment and structure
>1evh_A WH1 domain, protein (MENA EVH1 domain); molecular recognition, actin dynamics, contractIle protein; 1.80A {Mus musculus} SCOP: b.55.1.4 PDB: 2xqn_M 2iyb_A Back     alignment and structure
>1k5d_B RAN-specific GTPase-activating protein; ranbp1, rangap, GAP, signal transduction, nuclear transport, GTP hydrolysis, ground state; HET: GNP; 2.70A {Homo sapiens} SCOP: b.55.1.3 PDB: 1k5g_B* Back     alignment and structure
>3m1i_B RAN-specific GTPase-activating protein 1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1egx_A VAsp, vasodilator-stimulated phosphoprotein; EVH1, VAsp-ENA, poly-proline-binding domain, signaling protein; NMR {Homo sapiens} SCOP: b.55.1.4 Back     alignment and structure
>2crf_A RAN binding protein 3; RAN_BP1 domain, ranbp3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.3 Back     alignment and structure
>2y8g_A Ranbp3-B, RAN-binding protein 3; protein transport, CRM1-mediated nuclear export; 1.61A {Homo sapiens} PDB: 2y8f_A Back     alignment and structure
>1xod_A Spred1; sprouty, EVH1, peptide-binding, signaling protein; 1.15A {Xenopus tropicalis} SCOP: b.55.1.4 PDB: 1tj6_A Back     alignment and structure
>2jp2_A Spred-2, sprouty-related, EVH1 domain-containing protein 2; solution structure, structural genomics, structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>3syx_A Sprouty-related, EVH1 domain-containing protein 1; WH1 domain, human sprouty-related, EVH1 domain-containing PR Q7Z699; 2.45A {Homo sapiens} Back     alignment and structure
>1qc6_A EVH1 domain from ENA/VAsp-like protein; AN incomplete seven stranded anti-parallel beta barrel closed by AN alpha helix, EVH1 domain; 2.60A {Mus musculus} SCOP: b.55.1.4 Back     alignment and structure
>1ddw_A GLGF-domain protein homer; pleckstrin homology domain fold, signaling protein; 1.70A {Rattus norvegicus} SCOP: b.55.1.4 PDB: 1ddv_A 2p8v_A 1i7a_A* Back     alignment and structure
>1i2h_A PSD-ZIP45(homer-1C/VESL-1L); enabled VAsp homology 1 domain, signaling protein; 1.80A {Rattus norvegicus} SCOP: b.55.1.4 Back     alignment and structure
>1mke_A WIP - N-WAsp, fusion protein consisting of wiskott-aldrich syndrome protein interacting protein...; polyproline, protein-protein complex; NMR {Rattus norvegicus} SCOP: b.55.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 161
d1rrpb_134 b.55.1.3 (B:) Nuclear pore complex protein Nup358 1e-35
d1k5db_146 b.55.1.3 (B:) Ran-binding protein 1, Ranbp1 {Human 4e-31
d1xkea1118 b.55.1.3 (A:7-124) Ran-binding protein 2 {Human (H 9e-29
d2crfa1137 b.55.1.3 (A:8-144) Ran binding protein 3 {Human (H 9e-27
d1egxa_115 b.55.1.4 (A:) Vasodilator-stimulated phosphoprotei 3e-17
d1evha_111 b.55.1.4 (A:) Enabled {Mouse (Mus musculus) [TaxId 2e-16
>d1rrpb_ b.55.1.3 (B:) Nuclear pore complex protein Nup358 {Human (Homo sapiens) [TaxId: 9606]} Length = 134 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Ran-binding domain
domain: Nuclear pore complex protein Nup358
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  118 bits (297), Expect = 1e-35
 Identities = 56/145 (38%), Positives = 80/145 (55%), Gaps = 42/145 (28%)

Query: 14  FKPIIPLPDEVPVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVTTG 73
           F+P++PLPD++ V TGEE+E   F  RAKL+RF  +                        
Sbjct: 2   FEPVVPLPDKIEVKTGEEDEEEFFCNRAKLFRFDVE------------------------ 37

Query: 74  EENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHKICANHFLH 133
                              KEWKERG+G +K+L++K +GK+RLLMRR+ V KICANH++ 
Sbjct: 38  ------------------SKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYIS 79

Query: 134 QDMELKPMPNTKQAYIWFAQDYADE 158
            DM+L P   + ++++W A DYADE
Sbjct: 80  PDMKLTPNAGSDRSFVWHALDYADE 104
>d1k5db_ b.55.1.3 (B:) Ran-binding protein 1, Ranbp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1xkea1 b.55.1.3 (A:7-124) Ran-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2crfa1 b.55.1.3 (A:8-144) Ran binding protein 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1egxa_ b.55.1.4 (A:) Vasodilator-stimulated phosphoprotein (VASP) {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1evha_ b.55.1.4 (A:) Enabled {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
d1rrpb_134 Nuclear pore complex protein Nup358 {Human (Homo s 100.0
d1k5db_146 Ran-binding protein 1, Ranbp1 {Human (Homo sapiens 100.0
d2crfa1137 Ran binding protein 3 {Human (Homo sapiens) [TaxId 99.97
d1xkea1118 Ran-binding protein 2 {Human (Homo sapiens) [TaxId 99.96
d1evha_111 Enabled {Mouse (Mus musculus) [TaxId: 10090]} 99.87
d1egxa_115 Vasodilator-stimulated phosphoprotein (VASP) {Huma 99.82
d1xkea1118 Ran-binding protein 2 {Human (Homo sapiens) [TaxId 98.96
d1egxa_115 Vasodilator-stimulated phosphoprotein (VASP) {Huma 98.57
d1rrpb_134 Nuclear pore complex protein Nup358 {Human (Homo s 98.19
d1mkea1114 Actin regulatory protein WASP {Rat (Rattus norvegi 98.16
d1k5db_146 Ran-binding protein 1, Ranbp1 {Human (Homo sapiens 98.09
d1evha_111 Enabled {Mouse (Mus musculus) [TaxId: 10090]} 97.95
d2crfa1137 Ran binding protein 3 {Human (Homo sapiens) [TaxId 97.65
d1i2ha_145 Homer {Rat (Rattus norvegicus) [TaxId: 10116]} 97.51
d1xoda1114 Sprouty-related, EVH1 domain-containing protein 1, 96.16
>d1rrpb_ b.55.1.3 (B:) Nuclear pore complex protein Nup358 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Ran-binding domain
domain: Nuclear pore complex protein Nup358
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=6e-40  Score=245.90  Aligned_cols=106  Identities=53%  Similarity=1.032  Sum_probs=101.0

Q ss_pred             CccccccCCCccccccccccceeeeeeeceeeeeeccceeeecccceeeecccCCCccccCCCcceeeEEeeeeEeeeec
Q psy11674         13 DFKPIIPLPDEVPVTTGEENETVLFEQRAKLYRFVDKEWKERGVGQLKLLKNKDTGKVTTGEENETVLFEQRAKLYRFVD   92 (161)
Q Consensus        13 ~f~pv~~l~~~v~v~tgEE~E~~~f~~r~kl~~~~~~~wkerGvg~~kl~~~~~t~~i~tGEE~E~~lf~~raKL~~~~~   92 (161)
                      ||+|||+||++|+++||||+|+++|+.|||||+|++.                                          +
T Consensus         1 ~f~p~~~l~~~v~~~tgEE~E~~if~~r~KL~~~~~~------------------------------------------~   38 (134)
T d1rrpb_           1 HFEPVVPLPDKIEVKTGEEDEEEFFCNRAKLFRFDVE------------------------------------------S   38 (134)
T ss_dssp             CCCCSSCCCCCCCCCCSCCSEEEEEEEEEEEEEECSS------------------------------------------S
T ss_pred             CccCcccCCCccceecCccCcEEEEEEeeEEEEEcCC------------------------------------------C
Confidence            8999999999999999999999999999999999753                                          4


Q ss_pred             cceeeeccceeeeeecCCCCcEEEEEEeCCeeeEEEcccccCCcEEeecCCCCcEEEEEeeecCCCCC
Q psy11674         93 KEWKERGVGQLKLLKNKDTGKVRLLMRRDIVHKICANHFLHQDMELKPMPNTKQAYIWFAQDYADEVV  160 (161)
Q Consensus        93 ~~WkerGvG~lkil~~~~t~~~RilmR~d~~~kv~lN~~I~~~m~~~~~~~~~~a~~w~a~D~sd~~~  160 (161)
                      ++|++||+|+|||+++++++++|||||+|+++++||||.|+++|+++++.++.++|+|++.|++|+++
T Consensus        39 ~~WkerGvG~lkil~~~~t~~~RlvmR~d~~~kv~lN~~i~~~~~~~~~~~~~~~~~~~~~d~~~~~~  106 (134)
T d1rrpb_          39 KEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGSDRSFVWHALDYADELP  106 (134)
T ss_dssp             SCEEEEEEEEEEEEEESSSCCCEEEEECTTTCCEEECCBCCSSCCCBCSTTCTTEEEEEEEECTTSSC
T ss_pred             CceeeeeEEEEEEEEcCCCCcEEEEEEEcCCCcEEEEEEECCCcEEeecCCCceEEEEEeeccCCCCC
Confidence            67999999999999999999999999999999999999999999999999999999999999998864
>d1k5db_ b.55.1.3 (B:) Ran-binding protein 1, Ranbp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crfa1 b.55.1.3 (A:8-144) Ran binding protein 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkea1 b.55.1.3 (A:7-124) Ran-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1evha_ b.55.1.4 (A:) Enabled {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egxa_ b.55.1.4 (A:) Vasodilator-stimulated phosphoprotein (VASP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkea1 b.55.1.3 (A:7-124) Ran-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egxa_ b.55.1.4 (A:) Vasodilator-stimulated phosphoprotein (VASP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rrpb_ b.55.1.3 (B:) Nuclear pore complex protein Nup358 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkea1 b.55.1.4 (A:31-144) Actin regulatory protein WASP {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k5db_ b.55.1.3 (B:) Ran-binding protein 1, Ranbp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1evha_ b.55.1.4 (A:) Enabled {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crfa1 b.55.1.3 (A:8-144) Ran binding protein 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ha_ b.55.1.4 (A:) Homer {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xoda1 b.55.1.4 (A:10-123) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]} Back     information, alignment and structure