Diaphorina citri psyllid: psy11681


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
PLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRFISPTILVDVKPTDPIMGEEIFGPILPIINVESAFEAIQFINARPKPLTLYLFSSNAQVQELFIHQTHSGSMCINDTVMHY
cEEEcccccHHHHHHHHHHHHHHccccccccccEEEEcccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccEEEcccccccccEEccEEEcccccccccHHHcccccccccEEEccHHHHHHHHcccccccEEEEccccHHHHHHHHHccccccEEEccccccc
PLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRFISPTILVDVKPTDPIMGEEIFGPILPIINVESAFEAIQFINARPKPLTLYLFSSNAQVQELFIHQTHSGSMCINDTVMHY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRFISPTILVDVKPTDPIMGEEIFGPILPIINVESAFEAIQFINARPKPLTLYLFSSNAQVQELFIHQTHSGSMCINDTVMHY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016620 [MF]oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptorprobableGO:0003824, GO:0016903, GO:0003674, GO:0016491
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0006081 [BP]cellular aldehyde metabolic processprobableGO:0044710, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SZA, chain A
Confidence level:very confident
Coverage over the Query: 1-179
View the alignment between query and template
View the model in PyMOL