Diaphorina citri psyllid: psy11689

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390

MPVDLVRVCNTVLMYFAKHRGCTADSLLRHVRSSLSHYRPSCLKAGGLGVIDLPTAPQGRETELPFTKLNEEVELSENVQREEEGIAGENLQRGGGEEGIELREGGQRNGGEGGIGLNERVQRIGEGREERRDWEGEEEGAFVPELGGLKGVRALMEKTVEWPFKYAREFERLAIPKPKGILLYGPPGCAKTSLVRTLAAHSVYRVLAASAAQLYSPYVGEAEQNVTQLFHRARLAAPAILFIDEIERTYNCEYREQTADNAKKPRIPRTNGGYREQTADTANKPRIQRTKREYREQTADTAHKTRISRTNRGYREKTADTANKPRIPRTNRGYREYSAQNANTANKPRIQRTKREYREQTADTANKPRIQRIGNLSQRNRSSPKKVSRI

ccHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccEEEcccccccccccHHHHcccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccccEEEccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHcccccccEEEEEccccccHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccccCEEECccccccccccccccccccccccccCEEEcccccccHHHHHHHHHcccccccccccHHHHHHHccccccccccccccccc

**VDLVRVCNTVLMYFAKHRGCTADSLLRHVRSSLSHYRPSCLKAGGLGVIDLPTAPQGRETELPFTKLNEEVELSENVQREEEGIAGENLQRGGGEEGIELR************GLNERVQRIGE**EE**DWEGEEEGAFVPELGGLKGVRALMEKTVEWPFKYAREFERLAIPKPKGILLYGPPGCAKTSLVRTLAAHSVYRVLAASAAQLYSPYVGEAEQNVTQLFHRARLAAPAILFIDEIERTYNCE**************PRTNGGYREQTADTANKPRIQRTKREYREQTADTAHKTRISRTNRGYREKTADTANKPRIPRTNRGYREYSAQNANTANKPRIQRTKREY***********RIQ*******************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3D8B, chain A
Confidence level:very confident
Coverage over the Query: 121-380
View the alignment between query and template
View the model in PyMOL

Template: 3CF2, chain A
Confidence level:very confident
Coverage over the Query: 4-30,45-321,340-369
View the alignment between query and template
View the model in PyMOL

Template: 1R6B, chain X
Confidence level:confident
Coverage over the Query: 10-262
View the alignment between query and template
View the model in PyMOL