Psyllid ID: psy11693


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------58
MVVLGRRFEIYLLILLLTLTIVLVLPVVSVELLPMQQSKEKKAKKTKVPMVQVADFVSGVWSLEYVEQSKEKKAKKTKVPMVQVLEYVEQSKEKKAKKTKVPMVQVFTCEVCQQAFTRNADLKVHSMVHKIAQLHKCELCYKMFSDKLLYEKHKMVHRQVFTCEVCMRSFNDRKEFNEHIMKHEKEKLFSCNFCLKPFLRKDLLEAHVNSVHKDVKKYNCEECDKYYLSQGGVGCVFLYYLSQGELDSHVQTSHRGIKPYVCEICSKAFTQQYNLKHHLLLHGDGNSLFRCDQCGKAFSRKGHLVQHSFVHGGEKPFKCSYCPKAFSHKGHLNEHLYTHSENKCFQCKYCPKTFTLRKHLKAHTNKHEGVLPHTCLECSKCFSTKSELNRHAQIHGGVKPFACTVCNKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKHLEIVHGVITSNSANMNIPLQHITPQVQLHQQQQQQPPPQPAHIPPPQIQHIPPPIQHQPVQNIHPSIQHIQQNLQQNIQQNLQQNIQQNIQHLLQQNMHVANSSHHMSQQRMHQLYALHHDGYMTATASIMQ
ccccccccHHHHHHHHHcccEEEEEccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHccccccccccccccccccccccccHHHHHcccccccccccccccccccccccHHHHHccccccccccccccccccccccHHHHHHHccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccHHcccHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHccccEEEEccccc
cccccccHHHHHHHHHHHccccccccccccccEcccccHHHHccccccccccccccccccccccHHHHHHHcccccccccccccccEEcccccHHEHEccccccccccccccccEEccccHHHHHEHccccccccccccccccEccccHHHEHccEcccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccHEEHHHHcccccccccccccccEccccHHHEEEEHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHccccccccccHccccEcccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHEHHcccccccccccccHccHHHHcHHHHHEHEHHcccccccccEEcc
MVVLGRRFEIYLLILLLTLTIVLVLPVVsvellpmqqskekkakktkvpmVQVADFVSGVWSLEYVEQSKEkkakktkvPMVQVLEYVEQSKEkkakktkvpmvQVFTCEVCQQAFTRNADLKVHSMVHKIAQLHKCELCYKMFSDKLLYEKHKMVHRQVFTCEVCMRSFNDRKEFNEHIMKHEKEklfscnfclkpflrKDLLEAHVNSVhkdvkkynceecdkyylsqggvGCVFLYYLSqgeldshvqtshrgikpyVCEICSKAFTQQYNLKHHlllhgdgnslfrcdqcgkafsrkghlvqhsfvhggekpfkcsycpkafshkghlnehlythsenkcfqckycpktftLRKHLKAHtnkhegvlphtclecskcfstkseLNRHaqihggvkpfactvcnksflqkTQLQNhlythskvkpyncgicaksFVQRNTYIKHLEIVHGvitsnsanmniplqhitpqvqlhqqqqqqpppqpahipppqiqhipppiqhqpvqnihpSIQHIQQNLQQNIQQNLQQNIQQNIQHLLQQNMhvansshhmSQQRMHQLYALHHDGYMTATASIMQ
MVVLGRRFEIYLLILLLTLTIVLVLPVVSVELLpmqqskekkakktkvpmVQVADFVSGVWSLEYVEqskekkakktkvpmvQVLEYveqskekkakktkvpmvQVFTCEVCQQAFTRNADLKVHSMVHKIAQLHKCELCYKMFSDKLLYEKHKMVHRQVFTCEVCMRSFNDRKEFNEHIMKHEKEKLFSCNFCLKPFLRKDLLEAHVNSVHKDVKKYNCEECDKYYLSQGGVGCVFLYYLSQGELDSHVQTSHRGIKPYVCEICSKAFTQQYNLKHHLLLHGDGNSLFRCDQCGKAFSRKGHLVQHSFVHGGEKPFKCSYCPKAFSHKGHLNEHLYTHSENKCFQCKYCPKTFTLRKHLKAHTnkhegvlphtCLECSKCFSTKSELNRHAQIHGGVKPFACTVCNKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKHLEIVHGVITSNSANMNIPLQHITPQVQLHQQQQQQPPPQPAHIPPPQIQHIPPPIQHQPVQNIHPSIQHIQQNLQQNIQQNLQQNIQQNIQHLLQQNMHVANSSHHMSQQRMHQLYALHHDGYMTATASIMQ
MVVLGRRFEIYllillltltivlvlpvvsvellpMQQSkekkakktkVPMVQVADFVSGVWSLEYVEQSkekkakktkVPMVQVLEYVEQSkekkakktkVPMVQVFTCEVCQQAFTRNADLKVHSMVHKIAQLHKCELCYKMFSDKLLYEKHKMVHRQVFTCEVCMRSFNDRKEFNEHIMKHEKEKLFSCNFCLKPFLRKDLLEAHVNSVHKDVKKYNCEECDKYYLSQGGVGCVFLYYLSQGELDSHVQTSHRGIKPYVCEICSKAFTQQYNLKHHLLLHGDGNSLFRCDQCGKAFSRKGHLVQHSFVHGGEKPFKCSYCPKAFSHKGHLNEHLYTHSENKCFQCKYCPKTFTLRKHLKAHTNKHEGVLPHTCLECSKCFSTKSELNRHAQIHGGVKPFACTVCNKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKHLEIVHGVITSNSANMNIPLqhitpqvqlhqqqqqqpppqpahipppqiqhipppiqhqpvqnihpSiqhiqqnlqqniqqnlqqniqqniqhllqqnMHVANSSHHMSQQRMHQLYALHHDGYMTATASIMQ
**VLGRRFEIYLLILLLTLTIVLVLPVVSVELLP*************VPMVQVADFVSGVWSLEYVE**************VQVLEY************KVPMVQVFTCEVCQQAFTRNADLKVHSMVHKIAQLHKCELCYKMFSDKLLYEKHKMVHRQVFTCEVCMRSFNDRKEFNEHIMKHEKEKLFSCNFCLKPFLRKDLLEAHVNSVHKDVKKYNCEECDKYYLSQGGVGCVFLYYLSQGELDSHVQTSHRGIKPYVCEICSKAFTQQYNLKHHLLLHGDGNSLFRCDQCGKAFSRKGHLVQHSFVHGGEKPFKCSYCPKAFSHKGHLNEHLYTHSENKCFQCKYCPKTFTLRKHLKAHTNKHEGVLPHTCLECSKCFSTKSELNRHAQIHGGVKPFACTVCNKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKHLEIVHGVITSNSANMNIPLQ**********************************************************************************************LYALHHDGY*********
MVVLGRRFEIYLLILLLTLTIVLVLPVV**************************DFVSGVWS**********KAKKTKVPMVQVLEYVEQSKEKKAKKTKVPMVQVFTCEVCQQAFTRNADLKVHSMVHKIAQLHKCELCYKMFSDKLLYEKHKMVHRQVFTCEVCMRSFNDRKEFNEHIMKHEKEKLFSCNFCLKPFLRKDLLEAHVNSVHKDVKKYNCEECDKYYLSQGGVGCVFLYYLSQGELDSHVQTSHRGIKPYVCEICSKAFTQQYNLKHHLLLHGDGNSLFRCDQCGKAFSRKGHLVQHSFVHGGEKPFKCSYCPKAFSHKGHLNEHLYTHSENKCFQCKYCPKTFTLRKHLKAHTNKHEGVLPHTCLECSKCFSTKSELNRHAQIHGGVKPFACTVCNKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKHLEIVHGVITSNSANMNIPLQHITPQVQLHQQQQQQPPPQPAHIPPPQIQHIPPPIQHQPVQNIHPSIQHI******************************************HQLYALHHDGYMTATASIM*
MVVLGRRFEIYLLILLLTLTIVLVLPVVSVELLPMQQ***********PMVQVADFVSGVWSLEYV************VPMVQVLEYVEQ***********PMVQVFTCEVCQQAFTRNADLKVHSMVHKIAQLHKCELCYKMFSDKLLYEKHKMVHRQVFTCEVCMRSFNDRKEFNEHIMKHEKEKLFSCNFCLKPFLRKDLLEAHVNSVHKDVKKYNCEECDKYYLSQGGVGCVFLYYLSQGELDSHVQTSHRGIKPYVCEICSKAFTQQYNLKHHLLLHGDGNSLFRCDQCGKAFSRKGHLVQHSFVHGGEKPFKCSYCPKAFSHKGHLNEHLYTHSENKCFQCKYCPKTFTLRKHLKAHTNKHEGVLPHTCLECSKCFSTKSELNRHAQIHGGVKPFACTVCNKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKHLEIVHGVITSNSANMNIPLQHITPQ****************HIPPPQIQHIPPPIQHQPVQNIHPSIQHIQQNLQQNIQQNLQQNIQQNIQHLLQQNMHV**********RMHQLYALHHDGYMTATASIMQ
***LGRRFEIYLLILLLTLTIVLVLPVVSVELLPMQQSKEK**KKTKVPMVQVADFVSGVWSLEYVEQSKEKKAKKTKVPMVQVLEYVEQSKEKKAKKTKVPMVQVFTCEVCQQAFTRNADLKVHSMVHKIAQLHKCELCYKMFSDKLLYEKHKMVHRQVFTCEVCMRSFNDRKEFNEHIMKHEKEKLFSCNFCLKPFLRKDLLEAHVNSVHKDVKKYNCEECDKYYLSQGGVGCVFLYYLSQGELDSHVQTSHRGIKPYVCEICSKAFTQQYNLKHHLLLHGDGNSLFRCDQCGKAFSRKGHLVQHSFVHGGEKPFKCSYCPKAFSHKGHLNEHLYTHSENKCFQCKYCPKTFTLRKHLKAHTNKHEGVLPHTCLECSKCFSTKSELNRHAQIHGGVKPFACTVCNKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKHLEIVHGVITSNSANMNIPLQHITPQVQLHQQQQQQPPPQPAHIPPPQIQHIPPPIQHQPVQNIHPSIQHIQQNLQQNIQQNLQQNIQQNIQHLLQQNMHVANSSHHMSQQRMHQLYALHHDGYMTATASIMQ
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVLGRRFEIYLLILLLTLTIVLVLPVVSVELLPMQQSKEKKAKKTKVPMVQVADFVSGVWSLEYVEQSKEKKAKKTKVPMVQVLEYVEQSKEKKAKKTKVPMVQVFTCEVCQQAFTRNADLKVHSMVHKIAQLHKCELCYKMFSDKLLYEKHKMVHRQVFTCEVCMRSFNDRKEFNEHIMKHEKEKLFSCNFCLKPFLRKDLLEAHVNSVHKDVKKYNCEECDKYYLSQGGVGCVFLYYLSQGELDSHVQTSHRGIKPYVCEICSKAFTQQYNLKHHLLLHGDGNSLFRCDQCGKAFSRKGHLVQHSFVHGGEKPFKCSYCPKAFSHKGHLNEHLYTHSENKCFQCKYCPKTFTLRKHLKAHTNKHEGVLPHTCLECSKCFSTKSELNRHAQIHGGVKPFACTVCNKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKHLEIVHGVITSNSANMNIPLQHITPQVQLHQQQQQQPPPQPAHIPPPQIQHIPPPIQHQPVQNIHPSIQHIQQNLQQNIQQNLQQNIQQNIQHLLQQNMHVANSSHHMSQQRMHQLYALHHDGYMTATASIMQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query579 2.2.26 [Sep-21-2011]
P51523738 Zinc finger protein 84 OS yes N/A 0.594 0.466 0.354 9e-57
Q5JVG2852 Zinc finger protein 484 O no N/A 0.566 0.384 0.358 4e-56
P10076861 Zinc finger protein 26 OS no N/A 0.563 0.378 0.357 6e-56
Q9NZL3707 Zinc finger protein 224 O no N/A 0.576 0.472 0.350 3e-55
Q054811191 Zinc finger protein 91 OS no N/A 0.563 0.273 0.364 7e-55
Q14588700 Zinc finger protein 234 O no N/A 0.599 0.495 0.357 9e-55
Q8NHY6868 Zinc finger protein 28 ho no N/A 0.642 0.428 0.320 2e-54
Q9NYT6803 Zinc finger protein 226 O no N/A 0.590 0.425 0.356 3e-54
Q08ER8600 Zinc finger protein 543 O no N/A 0.632 0.61 0.334 4e-54
Q5CZA5627 Zinc finger protein 805 O no N/A 0.644 0.594 0.326 7e-54
>sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 Back     alignment and function desciption
 Score =  221 bits (564), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 129/364 (35%), Positives = 185/364 (50%), Gaps = 20/364 (5%)

Query: 107 FTCEVCQQAFTRNADLKVHSMVHKIAQLHKCELCYKMFSDKLLYEKHKMVH--RQVFTCE 164
           + C  C +AF+R + L  H   H   + + C  C + FS+K     H+ +H   + F C 
Sbjct: 291 YECGECGKAFSRKSHLISHWRTHTGEKPYGCNECGRAFSEKSNLINHQRIHTGEKPFECR 350

Query: 165 VCMRSFNDRKEFNEHIMKHEKEKLFSCNFCLKPFLRKDLLEAHVNSVHKDVKKYNCEECD 224
            C ++F+ + +   H   H   K F C+ C K F  K  L  H  ++H   K Y C EC 
Sbjct: 351 ECGKAFSRKSQLVTHHRTHTGTKPFGCSDCRKAFFEKSELIRH-QTIHTGEKPYECSECR 409

Query: 225 KYYLSQGGV-------------GCV--FLYYLSQGELDSHVQTSHRGIKPYVCEICSKAF 269
           K +  +  +             GC+     +  +  L SH Q +H G KP++C  C KAF
Sbjct: 410 KAFRERSSLINHQRTHTGEKPHGCIQCGKAFSQKSHLISH-QMTHTGEKPFICSKCGKAF 468

Query: 270 TQQYNLKHHLLLHGDGNSLFRCDQCGKAFSRKGHLVQHSFVHGGEKPFKCSYCPKAFSHK 329
           +++  L  H   H  G   + C +CGKAFS K  L  H  +H GEKP+ CS C KAF  K
Sbjct: 469 SRKSQLVRHQRTH-TGEKPYECSECGKAFSEKLSLTNHQRIHTGEKPYVCSECGKAFCQK 527

Query: 330 GHLNEHLYTHSENKCFQCKYCPKTFTLRKHLKAHTNKHEGVLPHTCLECSKCFSTKSELN 389
            HL  H  TH+  K ++C  C K F  +  L  H   H G  P+ C +C K FS KS+LN
Sbjct: 528 SHLISHQRTHTGEKPYECSECGKAFGEKSSLATHQRTHTGEKPYECRDCEKAFSQKSQLN 587

Query: 390 RHAQIHGGVKPFACTVCNKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKHLE 449
            H +IH G KP+ C++C K+F +K++L  HL TH+  KPY C  C K+F ++++ I H  
Sbjct: 588 THQRIHTGEKPYECSLCRKAFFEKSELIRHLRTHTGEKPYECNECRKAFREKSSLINHQR 647

Query: 450 IVHG 453
           I  G
Sbjct: 648 IHTG 651




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 Back     alignment and function description
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function description
>sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 Back     alignment and function description
>sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 Back     alignment and function description
>sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 Back     alignment and function description
>sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 Back     alignment and function description
>sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=1 SV=2 Back     alignment and function description
>sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=2 SV=3 Back     alignment and function description
>sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query579
443728181462 hypothetical protein CAPTEDRAFT_135345 [ 0.594 0.744 0.370 3e-62
348543634 792 PREDICTED: zinc finger protein 729-like 0.571 0.417 0.357 2e-60
348543788502 PREDICTED: zinc finger protein 99-like [ 0.573 0.661 0.361 3e-60
348539776670 PREDICTED: zinc finger protein 665-like 0.637 0.550 0.348 4e-60
348539780620 PREDICTED: zinc finger protein 99-like [ 0.604 0.564 0.374 9e-60
348545573566 PREDICTED: zinc finger protein 729-like 0.647 0.662 0.34 3e-59
326666730 1718 PREDICTED: zinc finger protein 729 [Dani 0.571 0.192 0.389 7e-59
292613245433 PREDICTED: zinc finger protein 271-like 0.651 0.870 0.343 1e-58
326680679516 PREDICTED: zinc finger protein 271-like 0.595 0.668 0.376 4e-58
291413280 867 PREDICTED: zinc finger protein 26-like [ 0.563 0.376 0.363 5e-58
>gi|443728181|gb|ELU14642.1| hypothetical protein CAPTEDRAFT_135345 [Capitella teleta] Back     alignment and taxonomy information
 Score =  246 bits (627), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 203/364 (55%), Gaps = 20/364 (5%)

Query: 107 FTCEVCQQAFTRNADLKVHSMVHKIAQLHKCELCYKMFSDKLLYEKHKMVH--RQVFTCE 164
           F C+VCQ+ F+R   L+ H  VH   +  +C++C K+FS K + E+H  VH  ++ F C+
Sbjct: 93  FECDVCQKTFSRKEVLEQHMRVHTGKRPFECDVCQKVFSQKRILERHMRVHTGKRPFECD 152

Query: 165 VCMRSFNDRKEFNEHIMKHEKEKLFSCNFCLKPFLRKDLLEAHVNSVHKDVKKYNCEECD 224
           VC + F+ +K    H+  H  ++ F C+ C K F +K +L+ H+  VH   + + C+ C 
Sbjct: 153 VCQKVFSQKKALERHVQVHTGKRPFECDVCQKTFYQKRVLKRHMR-VHTRKRPFECDVCQ 211

Query: 225 KYYLSQGGVG-------------CVFL--YYLSQGELDSHVQTSHRGIKPYVCEICSKAF 269
           K +  +G +              C      +  +G LD H++  H G KP+ C++C K F
Sbjct: 212 KTFSQKGNLKQHTRVHTGERPFECDVCQKTFSHKGHLDRHMRL-HTGEKPFECDVCQKTF 270

Query: 270 TQQYNLKHHLLLHGDGNSLFRCDQCGKAFSRKGHLVQHSFVHGGEKPFKCSYCPKAFSHK 329
           T++  L+ H  +H  G   F CD C K FS K HLVQH  VH GE+PF+C  C K FSHK
Sbjct: 271 TRKEVLEVHTRVHT-GERPFECDVCQKTFSNKVHLVQHLRVHTGERPFECDVCQKTFSHK 329

Query: 330 GHLNEHLYTHSENKCFQCKYCPKTFTLRKHLKAHTNKHEGVLPHTCLECSKCFSTKSELN 389
           GHLN H+  H+  K F+C  C KTF+ ++ L+ H   H G  P  C  C   FS K  LN
Sbjct: 330 GHLNRHIRLHTGEKPFECDVCHKTFSRKEVLERHMRVHTGKRPFECDVCQMTFSHKGHLN 389

Query: 390 RHAQIHGGVKPFACTVCNKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKHLE 449
           RH ++H G KPF C VC+K+F +K  L+ H+  H+  +P+ C +C  +F Q+    +H++
Sbjct: 390 RHVRLHTGEKPFECDVCHKTFSRKEVLERHMRVHTGKRPFECDVCQMTFSQKKALERHVQ 449

Query: 450 IVHG 453
           +  G
Sbjct: 450 VHTG 453




Source: Capitella teleta

Species: Capitella teleta

Genus: Capitella

Family: Capitellidae

Order: Capitellida

Class: Polychaeta

Phylum: Annelida

Superkingdom: Eukaryota

>gi|348543634|ref|XP_003459288.1| PREDICTED: zinc finger protein 729-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|348543788|ref|XP_003459364.1| PREDICTED: zinc finger protein 99-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|348539776|ref|XP_003457365.1| PREDICTED: zinc finger protein 665-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|348539780|ref|XP_003457367.1| PREDICTED: zinc finger protein 99-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|348545573|ref|XP_003460254.1| PREDICTED: zinc finger protein 729-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|326666730|ref|XP_003198356.1| PREDICTED: zinc finger protein 729 [Danio rerio] Back     alignment and taxonomy information
>gi|292613245|ref|XP_002661844.1| PREDICTED: zinc finger protein 271-like [Danio rerio] Back     alignment and taxonomy information
>gi|326680679|ref|XP_002661854.2| PREDICTED: zinc finger protein 271-like [Danio rerio] Back     alignment and taxonomy information
>gi|291413280|ref|XP_002722904.1| PREDICTED: zinc finger protein 26-like [Oryctolagus cuniculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query579
ZFIN|ZDB-GENE-110913-23 569 si:dkey-122c11.8 "si:dkey-122c 0.568 0.578 0.377 2.5e-65
ZFIN|ZDB-GENE-110913-143 984 si:ch211-209p16.3 "si:ch211-20 0.568 0.334 0.371 3.6e-65
ZFIN|ZDB-GENE-110913-141433 si:ch211-59m15.3 "si:ch211-59m 0.594 0.794 0.365 6.7e-65
ZFIN|ZDB-GENE-110913-163485 si:ch211-209p16.2 "si:ch211-20 0.571 0.682 0.371 1.4e-64
ZFIN|ZDB-GENE-110913-92548 si:ch211-271g18.3 "si:ch211-27 0.592 0.625 0.364 9.7e-64
ZFIN|ZDB-GENE-110913-135 689 si:ch211-207e19.14 "si:ch211-2 0.594 0.499 0.346 1.6e-63
ZFIN|ZDB-GENE-120709-1465 si:dkey-8o9.6 "si:dkey-8o9.6" 0.564 0.703 0.381 1.6e-63
ZFIN|ZDB-GENE-110913-140485 si:dkey-54i3.4 "si:dkey-54i3.4 0.571 0.682 0.365 2e-63
ZFIN|ZDB-GENE-120214-24704 si:dkey-195o9.2 "si:dkey-195o9 0.568 0.467 0.376 3.3e-63
ZFIN|ZDB-GENE-110914-127580 si:dkey-54f18.1 "si:dkey-54f18 0.568 0.567 0.376 3.3e-63
ZFIN|ZDB-GENE-110913-23 si:dkey-122c11.8 "si:dkey-122c11.8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 665 (239.2 bits), Expect = 2.5e-65, P = 2.5e-65
 Identities = 131/347 (37%), Positives = 177/347 (51%)

Query:   109 CEVCQQAFTRNADLKVHSMVHKIAQLHKCELCYKMFSDKLLYEKHKMVH--RQVFTCEVC 166
             C  C   F R  DLK+H  +H   +   C  C K F        H M+H   + FTC  C
Sbjct:     1 CTQCGSNFGRKGDLKIHMRIHTGEKPFTCTQCGKSFRQSSSLNYHMMIHTGEKPFTCSQC 60

Query:   167 MRSFNDRKEFNEHIMKHEKEKLFSCNFCLKPFLRKDLLEAHVNSVHKDVKKYNCEECDKY 226
             ++SF+     N+H+M H  EK FSC  C K F     L+ H+  +H   K + C +C K 
Sbjct:    61 VKSFSCSSHLNKHMMIHTGEKPFSCTQCGKSFRHSLFLKQHM-MIHTGEKPFTCTQCGKS 119

Query:   227 YLSQGGVGCVFLYYLSQGELDSHVQTSHRGIKPYVCEICSKAFTQQYNLKHHLLLHGDGN 286
             + SQ               L+ H++  H G KP+ C  C K+F Q   L  H+++H  G 
Sbjct:   120 F-SQSS------------SLNHHMRI-HTGEKPFTCTQCGKSFIQSSQLNRHIMIH-TGE 164

Query:   287 SLFRCDQCGKAFSRKGHLVQHSFVHGGEKPFKCSYCPKAFSHKGHLNEHLYTHSENKCFQ 346
               F C QCGK+FS+  +   H  +H GEKP+ C++C K+FS    LNEH+  HS  K F 
Sbjct:   165 KPFTCTQCGKSFSQSSNFNLHMMIHTGEKPYTCTHCGKSFSKSSSLNEHMTIHSGEKPFT 224

Query:   347 CKYCPKTFTLRKHLKAHTNKHEGVLPHTCLECSKCFSTKSELNRHAQIHGGVKPFACTVC 406
             C  C K+F+   HL  H   H G  P TC +C   FS  S LN+H  IH G KPF CT C
Sbjct:   225 CTQCRKSFSCSSHLNHHMRIHTGEKPFTCTQCGNRFSRSSNLNQHMMIHTGEKPFTCTQC 284

Query:   407 NKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKHLEIVHG 453
              KSF Q + L +H+  H+  KP+ C  C KSF+Q +   +H+ I  G
Sbjct:   285 GKSFSQSSSLNHHMRIHTGEKPFTCTQCGKSFIQSSQLNRHMRIHTG 331


GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
ZFIN|ZDB-GENE-110913-143 si:ch211-209p16.3 "si:ch211-209p16.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-141 si:ch211-59m15.3 "si:ch211-59m15.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-163 si:ch211-209p16.2 "si:ch211-209p16.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-92 si:ch211-271g18.3 "si:ch211-271g18.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-135 si:ch211-207e19.14 "si:ch211-207e19.14" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120709-1 si:dkey-8o9.6 "si:dkey-8o9.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-140 si:dkey-54i3.4 "si:dkey-54i3.4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120214-24 si:dkey-195o9.2 "si:dkey-195o9.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-127 si:dkey-54f18.1 "si:dkey-54f18.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query579
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 3e-10
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 9e-08
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 1e-06
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 3e-06
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 6e-06
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 2e-05
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 2e-04
pfam03153 332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 3e-04
COG5048 467 COG5048, COG5048, FOG: Zn-finger [General function 4e-04
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 5e-04
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 0.002
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 0.003
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.003
pfam07223 357 pfam07223, DUF1421, Protein of unknown function (D 0.003
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
 Score = 62.9 bits (153), Expect = 3e-10
 Identities = 31/123 (25%), Positives = 41/123 (33%), Gaps = 13/123 (10%)

Query: 463 NIPLQHITPQVQLHQQQQQQPPPQPAH--IPPPQIQHIPPPIQHQPVQ---------NIH 511
             P     PQ     QQ   PPPQP      PPQ Q  PPP                 + 
Sbjct: 238 QQPPPLQQPQFPGLSQQMPPPPPQPPQQQQQPPQPQAQPPPQNQPTPHPGLPQGQNAPLP 297

Query: 512 PSIQHIQQNLQQNIQQNLQQNIQQNIQ-HLLQQNMHVANSSHHMSQQRMHQLYAL-HHDG 569
           P  Q     L Q  Q   +    +     L QQ     +       +R H++ +L  ++G
Sbjct: 298 PPQQPQLLPLVQQPQGQQRGPQFREQLVQLSQQQREALSQEEAKRAKRRHKIVSLSKYNG 357

Query: 570 YMT 572
            MT
Sbjct: 358 LMT 360


Members of this family are necessary for accurate chromosome transmission during cell division. Length = 804

>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 579
KOG2462|consensus279 99.96
KOG1074|consensus958 99.96
KOG1074|consensus958 99.96
KOG2462|consensus279 99.95
KOG3608|consensus467 99.95
KOG3608|consensus467 99.94
KOG3623|consensus1007 99.91
KOG3623|consensus 1007 99.9
KOG3576|consensus267 99.74
KOG3576|consensus267 99.7
PLN03086567 PRLI-interacting factor K; Provisional 99.38
PLN03086567 PRLI-interacting factor K; Provisional 99.33
PHA00733128 hypothetical protein 99.16
PHA00733128 hypothetical protein 99.06
KOG3993|consensus500 98.95
PHA0276855 hypothetical protein; Provisional 98.84
KOG3993|consensus500 98.83
PHA0276855 hypothetical protein; Provisional 98.79
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.56
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.55
PHA0061644 hypothetical protein 98.34
PHA0061644 hypothetical protein 98.3
PHA0073279 hypothetical protein 98.05
PHA0073279 hypothetical protein 98.0
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.93
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.66
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.64
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.49
COG5189423 SFP1 Putative transcriptional repressor regulating 97.45
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.36
KOG2231|consensus 669 97.36
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.34
KOG1146|consensus 1406 97.32
KOG2231|consensus 669 97.32
COG5189423 SFP1 Putative transcriptional repressor regulating 97.26
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.23
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.19
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.08
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.02
KOG1146|consensus1406 96.83
COG5048467 FOG: Zn-finger [General function prediction only] 96.62
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.44
COG5236493 Uncharacterized conserved protein, contains RING Z 96.34
smart0035526 ZnF_C2H2 zinc finger. 96.32
COG5236493 Uncharacterized conserved protein, contains RING Z 96.29
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.23
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.22
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.05
smart0035526 ZnF_C2H2 zinc finger. 96.04
PRK04860160 hypothetical protein; Provisional 95.97
KOG3598|consensus2220 95.91
KOG2785|consensus390 95.82
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.72
PRK04860160 hypothetical protein; Provisional 95.71
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.65
COG5048467 FOG: Zn-finger [General function prediction only] 95.65
KOG2785|consensus390 94.87
KOG3598|consensus 2220 94.69
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.58
KOG2482|consensus423 94.43
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.24
KOG2482|consensus423 94.12
KOG1883|consensus1517 93.67
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.13
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.8
KOG4173|consensus253 91.27
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 90.4
KOG4173|consensus253 90.19
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 90.02
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 89.87
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 89.59
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 89.01
KOG2893|consensus341 88.78
KOG2893|consensus341 88.69
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 88.59
PF11498468 Activator_LAG-3: Transcriptional activator LAG-3; 88.55
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 88.43
COG404965 Uncharacterized protein containing archaeal-type C 87.71
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 86.67
COG404965 Uncharacterized protein containing archaeal-type C 86.15
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 84.25
KOG2186|consensus276 83.64
KOG1883|consensus1517 81.19
>KOG2462|consensus Back     alignment and domain information
Probab=99.96  E-value=1.3e-30  Score=235.58  Aligned_cols=135  Identities=39%  Similarity=0.729  Sum_probs=123.3

Q ss_pred             CCccccCCCCCcCCChhHHHhhhcccC---CCCccccCCCcccccChHHHHHHHhccCCCCCCCCccchhccCCHHHHHH
Q psy11693        314 EKPFKCSYCPKAFSHKGHLNEHLYTHS---ENKCFQCKYCPKTFTLRKHLKAHTNKHEGVLPHTCLECSKCFSTKSELNR  390 (579)
Q Consensus       314 ~~~~~C~~C~~~f~~~~~l~~H~~~h~---~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  390 (579)
                      ...|+|+.||+.+.+.++|.+|..+|.   ..+.+.|++|||.|.+...|+.|+++|+  .+++|.+|||.|....-|+.
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhc
Confidence            345888889999999999999988885   3677999999999999999999999998  78999999999999999999


Q ss_pred             HhhhhCCCcceeccccchhcCCHHHHHHHHHHhCCCCccccccccccccCHHHHHHHHHH
Q psy11693        391 HAQIHGGVKPFACTVCNKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKHLEI  450 (579)
Q Consensus       391 H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~  450 (579)
                      |+|+|||||||.|..|++.|.++++|+.||.+|.++|+|.|..|+++|...+.|.+|...
T Consensus       206 HiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             ccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            999999999999999999999999999999999999999999999999999999999865



>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG3598|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG3598|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG1883|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF11498 Activator_LAG-3: Transcriptional activator LAG-3; InterPro: IPR021587 The C Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>KOG1883|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query579
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 8e-35
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 8e-15
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-13
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 7e-14
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 5e-13
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-11
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-11
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 2e-11
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 2e-09
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 2e-09
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-11
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 1e-10
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-08
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 3e-10
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 3e-10
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 4e-10
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 9e-06
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 4e-10
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 4e-10
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 4e-10
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 5e-10
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-10
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 6e-10
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 9e-10
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-09
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 2e-09
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 3e-08
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-07
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-06
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-07
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 3e-07
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-07
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 1e-06
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 8e-05
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 3e-07
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 3e-07
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 5e-07
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 1e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 3e-05
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 8e-05
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 2e-06
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 7e-06
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 2e-06
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 5e-06
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 2e-05
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 6e-05
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-04
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 9e-04
2ytb_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 9e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 145 bits (365), Expect = 8e-35, Method: Compositional matrix adjust. Identities = 73/173 (42%), Positives = 95/173 (54%) Query: 285 GNSLFRCDQCGKAFSRKGHLVQHSFVHGGEKPFKCSYCPKAFSHKGHLNEHLYTHSENKC 344 G + C +CGK+FSR HL +H H GEKP+KC C K+FS K L H TH+ K Sbjct: 18 GEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKP 77 Query: 345 FQCKYCPKTFTLRKHLKAHTNKHEGVLPHTCLECSKCFSTKSELNRHAQIHGGVKPFACT 404 ++C C K+F+ R +L+AH H G P+ C EC K FS + L H + H G KP+ C Sbjct: 78 YKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCP 137 Query: 405 VCNKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKHLEIVHGVITS 457 C KSF ++ L H TH+ KPY C C KSF +R+ H G TS Sbjct: 138 ECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS 190
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2YTB|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 5 In Zinc Finger Protein 32 Length = 42 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query579
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-49
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-49
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-27
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-37
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-29
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-18
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-33
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-32
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-25
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-23
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-15
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-32
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-31
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-18
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-17
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-31
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-31
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-18
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-09
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-30
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-24
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-22
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-15
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-28
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-26
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-23
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-18
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-27
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-27
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-15
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-26
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-25
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-25
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-20
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-19
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-25
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-25
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-19
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-18
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-24
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-23
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-20
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-15
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-23
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-18
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-18
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-22
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-17
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-16
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-22
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-19
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-19
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-16
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-22
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-20
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-19
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-17
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-22
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-21
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-18
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-12
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-20
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-20
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-19
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-16
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-19
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-17
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-15
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 8e-19
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-16
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-16
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-17
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-11
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 8e-17
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-15
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-14
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-16
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 9e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-11
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-10
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-16
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-14
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-13
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-12
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-15
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-14
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 6e-14
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-16
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-12
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-16
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-16
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-14
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-15
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-13
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-12
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-12
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-13
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 5e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 5e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 5e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-12
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 6e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-08
2epa_A72 Krueppel-like factor 10; transforming growth facto 8e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-10
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-10
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-09
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-09
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 6e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 5e-09
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 8e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 6e-09
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 5e-08
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 5e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 8e-09
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 7e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 8e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 9e-08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 5e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 7e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 6e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 9e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 4e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 8e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 5e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-05
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 4e-04
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 8e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  168 bits (428), Expect = 2e-49
 Identities = 71/180 (39%), Positives = 95/180 (52%), Gaps = 1/180 (0%)

Query: 268 AFTQQYNLKHHLLLHGDGNSLFRCDQCGKAFSRKGHLVQHSFVHGGEKPFKCSYCPKAFS 327
           +     +      L   G   + C +CGK+FSR  HL +H   H GEKP+KC  C K+FS
Sbjct: 2   SEFGSSSSVAQAALE-PGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFS 60

Query: 328 HKGHLNEHLYTHSENKCFQCKYCPKTFTLRKHLKAHTNKHEGVLPHTCLECSKCFSTKSE 387
            K  L  H  TH+  K ++C  C K+F+ R +L+AH   H G  P+ C EC K FS  + 
Sbjct: 61  DKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAH 120

Query: 388 LNRHAQIHGGVKPFACTVCNKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKH 447
           L  H + H G KP+ C  C KSF ++  L  H  TH+  KPY C  C KSF +R+    H
Sbjct: 121 LRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVH 180


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query579
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.9
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.89
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.89
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.88
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.78
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.78
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.78
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.77
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.77
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.76
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.75
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.75
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.75
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.75
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.74
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.74
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.72
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.71
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.7
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.68
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.68
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.66
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.66
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.65
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.64
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.63
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.62
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.61
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.61
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.6
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.59
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.57
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.57
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.57
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.56
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.55
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.54
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.53
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.53
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.52
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.51
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.5
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.49
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.49
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.48
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.48
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.47
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.47
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.46
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.46
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.45
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.45
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.43
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.43
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.42
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.42
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.42
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.41
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.39
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.39
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.33
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.33
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.31
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.3
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.29
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.27
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.25
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.22
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.21
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.2
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.2
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.19
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.19
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.19
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.18
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.18
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.17
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.17
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.13
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.12
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.12
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.03
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.03
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.03
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.01
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.01
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.0
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.0
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.99
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.98
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.97
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.96
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.96
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.95
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.95
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.94
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.94
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.94
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.93
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.92
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.9
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.9
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.9
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.89
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.89
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.89
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.88
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.87
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.84
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.83
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.81
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.81
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.79
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.78
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.78
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.71
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.71
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.63
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.62
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.61
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.59
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.57
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.55
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.51
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.51
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.5
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.41
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.41
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.4
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.31
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.3
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.26
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.24
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.22
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.22
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.17
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.14
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.13
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.12
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.1
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.08
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.08
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.07
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.06
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.03
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.0
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.99
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.98
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.97
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.97
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.97
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.96
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.94
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.94
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.16
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.16
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.92
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.91
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.9
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.89
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.89
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.86
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.07
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.85
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.85
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.83
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.83
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.83
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.82
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.03
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.77
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.77
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.94
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.72
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.67
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.75
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.5
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.48
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.34
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.18
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.71
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.14
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.09
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.7
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.4
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.38
3iot_A449 Maltose-binding protein, huntingtin fusion protei; 95.32
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.34
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.44
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 91.22
3iot_A449 Maltose-binding protein, huntingtin fusion protei; 91.16
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 88.47
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 86.98
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 85.42
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 81.33
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.36
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=7e-38  Score=288.94  Aligned_cols=182  Identities=40%  Similarity=0.754  Sum_probs=134.9

Q ss_pred             HHHHHHHHhhCCCCcccccccccccccCchhhccccccccCCCccccCCCCCcCCChhHHHhhhcccCCCCccccCCCcc
Q psy11693        273 YNLKHHLLLHGDGNSLFRCDQCGKAFSRKGHLVQHSFVHGGEKPFKCSYCPKAFSHKGHLNEHLYTHSENKCFQCKYCPK  352 (579)
Q Consensus       273 ~~L~~H~~~h~~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  352 (579)
                      ..|..|+..| .++++|.|+.|++.|.+...|..|++.|+++++|.|+.|++.|.+...|..|+++|+++++|.|++|++
T Consensus         7 ~~l~~h~~~~-~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   85 (190)
T 2i13_A            7 SSSVAQAALE-PGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGK   85 (190)
T ss_dssp             -------------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCC
T ss_pred             ccchhhhhhc-CCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCC
Confidence            4566777777 467788888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             cccChHHHHHHHhccCCCCCCCCccchhccCCHHHHHHHhhhhCCCcceeccccchhcCCHHHHHHHHHHhCCCCccccc
Q psy11693        353 TFTLRKHLKAHTNKHEGVLPHTCLECSKCFSTKSELNRHAQIHGGVKPFACTVCNKSFLQKTQLQNHLYTHSKVKPYNCG  432 (579)
Q Consensus       353 ~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~  432 (579)
                      .|.+...|..|++.|.++++|.|++|++.|.+...|..|+++|+++++|.|++|++.|.+...|..|+++|++++||.|+
T Consensus        86 ~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~  165 (190)
T 2i13_A           86 SFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCP  165 (190)
T ss_dssp             EESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECT
T ss_pred             ccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECC
Confidence            88888888888888888888889889999988888999988888888899999999999888899998888888889999


Q ss_pred             cccccccCHHHHHHHHHHHcCCC
Q psy11693        433 ICAKSFVQRNTYIKHLEIVHGVI  455 (579)
Q Consensus       433 ~C~~~f~~~~~l~~H~~~~h~~~  455 (579)
                      +|++.|.+...|..|+++++|..
T Consensus       166 ~C~~~f~~~~~L~~H~~~H~~~k  188 (190)
T 2i13_A          166 ECGKSFSRRDALNVHQRTHTGKK  188 (190)
T ss_dssp             TTCCEESSHHHHHHHHTTC----
T ss_pred             CCCCccCCHHHHHHHHHhcCCCC
Confidence            99999999999999988877654



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 579
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 8e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 6e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.004
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 6e-08
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.003
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.002
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 8e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.001
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 4e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.001
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 4e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 5e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 6e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.002
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.003
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 2e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 8e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 6e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 7e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 8e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.001
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.001
d2epra135 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [ 0.003
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 50.5 bits (120), Expect = 4e-09
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 314 EKPFKCSYCPKAFSHKGHLNEHLYTHSENKCFQCKYCPKTFTLRKHLKAHTNKH 367
           +K + C  C K+F+HK   + H+  H   + + C  C K F ++ HL  H   H
Sbjct: 1   DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH 53


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query579
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.57
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.56
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.21
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.16
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.14
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.1
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.09
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.08
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.02
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.0
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.0
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.95
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.94
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.92
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.92
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.91
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.88
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.86
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.86
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.85
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.84
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.8
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.79
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.77
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.75
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.64
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.62
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.61
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.57
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.56
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.54
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.49
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.46
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.37
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.33
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.26
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.26
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.23
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.22
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.19
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.16
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.11
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.05
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.04
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.96
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.9
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.78
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.77
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.74
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.7
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.6
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.6
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.59
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.56
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.5
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.5
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.44
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.44
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.43
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.22
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.19
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.17
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.16
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.09
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.07
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.01
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.01
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.0
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.95
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.94
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.9
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.75
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.69
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.55
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.52
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.48
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.45
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.3
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.18
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.15
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.11
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.0
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.97
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.94
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.68
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.6
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.35
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.21
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.13
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.13
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.09
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.68
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.67
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.54
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.47
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.0
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.59
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.48
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 91.07
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.62
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 90.36
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.79
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.01
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 88.86
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 87.53
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 87.04
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 85.96
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 85.86
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 85.72
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 85.69
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 85.69
d1y0jb136 U-shaped transcription factor, different fingers { 85.02
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 84.22
d1y0jb136 U-shaped transcription factor, different fingers { 84.18
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 83.15
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 83.04
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 82.74
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 81.33
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 81.2
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.57  E-value=5.2e-16  Score=106.87  Aligned_cols=52  Identities=37%  Similarity=0.867  Sum_probs=34.0

Q ss_pred             CcceeccccchhcCCHHHHHHHHHHhCCCCccccccccccccCHHHHHHHHHH
Q psy11693        398 VKPFACTVCNKSFLQKTQLQNHLYTHSKVKPYNCGICAKSFVQRNTYIKHLEI  450 (579)
Q Consensus       398 ~k~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~  450 (579)
                      ||||.|. ||++|.....|..|+++|+|++||.|++||++|.+.+.|..|+++
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~   52 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKI   52 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhc
Confidence            4566663 666666666666666666666666666666666666666666654



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure