Diaphorina citri psyllid: psy11727

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------

MNNVINAGSPLYGRLVADNSIQNQDILSMQARIPMQFRDPATAPLRKLSVDLIKTYKHINEVYYTKKKRKAQLSHNETRSNKKEKKYVHNDGHDDENYDYIIKHGEKFLDRYEIDTLLGKGSFGQVVKAFDHEEKCQVAIKIIKNKKPFLNQAQIEVQLLEKINKADIHSRYIVKLKGHFTWKNHLCLVFELLSYNLYNLIRNTNFHGVSLNLTKKFAQQLCCALAFLSSPELSIIHCDLKPENILLCSPKRSAIKIIDFGSSCHVGQTLYQYIQSRYYRSPEVLLGIPYDLAIDMWSLGCILVELHTGEPLFSGKNEVDQMTKIIEVLGMPPGYLLHGASKTSKYFDRLSDNSYVLKKSTDTRKERLPGSKRLDTILGVDNGGPGGRRRNEPGHSLADYMKFKDLILRMLTYDPKKRISPTNVLRHEFFLKHSVDN

cccccccccccccccccccccccccccHHHHccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEccEEcccEEEEccccccccccEEEEEEcccccEEEEEEEEccHHHHHHHHHHHHHHHHHHHcccccccEEEEEcEEccccEEEEEEccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccEECcccccccEEEcccccccEEEECcccccccccEEEEEcccccccccHHHccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHcccccccccccc

**********LYGRLVADNSIQNQDILSMQARIPMQFRDPATAPLRKLSVDLIKTYKHINEVYYTKK************************GHDDENYDYIIKHGEKFLDRYEIDTLLGKGSFGQVVKAFDHEEKCQVAIKIIKNKKPFLNQAQIEVQLLEKINKADIHSRYIVKLKGHFTWKNHLCLVFELLSYNLYNLIRNTNFHGVSLNLTKKFAQQLCCALAFLSSPELSIIHCDLKPENILLCSPKRSAIKIIDFGSSCHVGQTLYQYIQSRYYRSPEVLLGIPYDLAIDMWSLGCILVELHTGEPLFSGKNEVDQMTKIIEVLGMPPGYLLHGASKTSKYFDRLSDNSYV****************************************LADYMKFKDLILRMLTYDPKKRISPTNVLRHEFFLKH****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dual specificity tyrosine-phosphorylation-regulated kinase 1A	May play a role in a signaling pathway regulating nuclear functions of cell proliferation. Phosphorylates serine, threonine and tyrosine residues in its sequence and in exogenous substrates.	confident	Q61214
Dual specificity tyrosine-phosphorylation-regulated kinase 1A	May play a role in a signaling pathway regulating nuclear functions of cell proliferation. Phosphorylates serine, threonine and tyrosine residues in its sequence and in exogenous substrates.	confident	Q13627
Dual specificity tyrosine-phosphorylation-regulated kinase 1A	May play a role in a signaling pathway regulating nuclear functions of cell proliferation. Phosphorylates serine, threonine and tyrosine residues in its sequence and in exogenous substrates.	confident	Q63470

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045893 [BP]	positive regulation of transcription, DNA-dependent	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0003713 [MF]	transcription coactivator activity	probable	GO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0035556 [BP]	intracellular signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0007623 [BP]	circadian rhythm	probable	GO:0048511, GO:0008150
GO:0051128 [BP]	regulation of cellular component organization	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0000287 [MF]	magnesium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0018107 [BP]	peptidyl-threonine phosphorylation	probable	GO:0044267, GO:0006468, GO:0009987, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0018210, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0018105 [BP]	peptidyl-serine phosphorylation	probable	GO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0008355 [BP]	olfactory learning	probable	GO:0032501, GO:0007635, GO:0044707, GO:0042048, GO:0044708, GO:0050896, GO:0007612, GO:0007610, GO:0007611, GO:0008306, GO:0008150, GO:0050890, GO:0050877, GO:0042221, GO:0044699, GO:0003008
GO:0007166 [BP]	cell surface receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032880 [BP]	regulation of protein localization	probable	GO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0004674 [MF]	protein serine/threonine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0044732 [CC]	mitotic spindle pole body	probable	GO:0043234, GO:0005856, GO:0072686, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005816, GO:0044422, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630, GO:0005622
GO:0043393 [BP]	regulation of protein binding	probable	GO:0008150, GO:0065009, GO:0051098, GO:0065007
GO:0051049 [BP]	regulation of transport	probable	GO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0007520 [BP]	myoblast fusion	probable	GO:0030154, GO:0061061, GO:0014706, GO:0000768, GO:0006949, GO:0009653, GO:0007275, GO:0044699, GO:0007517, GO:0051146, GO:0007519, GO:0048513, GO:0048869, GO:0035914, GO:0048646, GO:0032502, GO:0032501, GO:0014902, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0016607 [CC]	nuclear speck	probable	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006810 [BP]	transport	probable	GO:0051234, GO:0008150, GO:0051179
GO:0043518 [BP]	negative regulation of DNA damage response, signal transduction by p53 class mediator	probable	GO:0010646, GO:0009968, GO:0023057, GO:0009966, GO:0050789, GO:0048585, GO:0080135, GO:0048583, GO:0050794, GO:0023051, GO:2001021, GO:0065007, GO:0048519, GO:0008150, GO:1901796, GO:1901797, GO:2001020, GO:0043516, GO:0080134, GO:0048523, GO:0010648
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:1901700 [BP]	response to oxygen-containing compound	probable	GO:0042221, GO:0050896, GO:0008150
GO:0030218 [BP]	erythrocyte differentiation	probable	GO:0030154, GO:0042592, GO:0007275, GO:0044699, GO:0048869, GO:0002262, GO:0008150, GO:0048513, GO:0065007, GO:0048534, GO:0065008, GO:0032502, GO:0034101, GO:0032501, GO:0009987, GO:0044767, GO:0044763, GO:0030097, GO:0002520, GO:0048872, GO:0044707, GO:0048856, GO:0002376, GO:0030099, GO:0048731
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0016605 [CC]	PML body	probable	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0032153 [CC]	cell division site	probable	GO:0005575, GO:0044464, GO:0005623
GO:0044448 [CC]	cell cortex part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0051286 [CC]	cell tip	probable	GO:0005575, GO:0044464, GO:0005623, GO:0060187
GO:0045892 [BP]	negative regulation of transcription, DNA-dependent	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0030529 [CC]	ribonucleoprotein complex	probable	GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0004715 [MF]	non-membrane spanning protein tyrosine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004713, GO:0004672
GO:0004712 [MF]	protein serine/threonine/tyrosine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0090312 [BP]	positive regulation of protein deacetylation	probable	GO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0090311, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0050789, GO:0032270, GO:0008150, GO:0031399, GO:0048518, GO:0065007, GO:0019222, GO:0010604, GO:0031325, GO:0048522
GO:0033554 [BP]	cellular response to stress	probable	GO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0051641 [BP]	cellular localization	probable	GO:0008150, GO:0009987, GO:0044763, GO:0051179, GO:0044699
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0007632 [BP]	visual behavior	probable	GO:0009628, GO:0044702, GO:0044704, GO:0044707, GO:0019098, GO:0009314, GO:0050896, GO:0007610, GO:0022414, GO:0032501, GO:0009416, GO:0044708, GO:0008150, GO:0044699, GO:0000003
GO:0009725 [BP]	response to hormone stimulus	probable	GO:0009719, GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0007399 [BP]	nervous system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.12.-	Dual-specificity kinases (those acting on Ser/Thr and Tyr residues).	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VX3, chain A
Confidence level:very confident
Coverage over the Query: 101-432
View the alignment between query and template
View the model in PyMOL

Template: 4FIF, chain A
Confidence level:probable
Coverage over the Query: 85-350
View the alignment between query and template
View the model in PyMOL