Diaphorina citri psyllid: psy11730

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490------

MVSTSETSKVLDSRARKRIKETKKRARPELNGKDAWFELGYADKFDKFKIVKENVERIHVKDYSPQEFIEKYEKPNKPVVIKGVTENWNATYKWTLEKLGKKYRNQKFKCGEDNHGYSKLGKKYRNQKFKCGEDNHGYSHPRRKKLLDDYEVPIYFQDDLFQYAGEDKRPPYRWFVMGPARSGTGIHIDPLGTNPDDGDVKDDSPAVESKEFKPIDEILTNIISELGKQVENLTSVSNIKLLRTPLFEYETFVNISHTDLKPNVYEGGYKIWECTFDLLNFIKDNVAVDKLSVLDVGCGAGLLGLYTLMNGAAHVSFQDYNQEVIESLTLPNILMNTDNLEKCKFYHGDWGSLSAVIHSKFDIILTSETIYSVANYNKLLTVWCLFPTHTPKDLLKVTSAEGGKQRDEAITWFSIIYPRTQLPSWPTEWKPLELVQGPGETVFVPGGWWHVVLNLDTTVAVTQNFCSHTNFPVVYHKTIRGRPKLSKKWYRKLKTR

cccccccHHHHHHHHHHHHHHHHHHcccccccccccHHccccccccccccccccCEEEccccccHHHHHHHHccccccEEEEcccccccccccccHHHHHHHccccEEEEccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccEEcccccccccccccccEEccccccccccccccccEEEHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHccccEEEEEcccHHHHHHcccccccccccccccEEEEccccccHHHHHHcccEEEEccccEEcccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEccccEEEEEEcccEEEEEEccccccccHHHHHHHHccccccHHHHHHHHHcc

******************************NGKDAWFELGYADKFDKFKIVKENVERIHVKDYSPQEFIEKYEKPNKPVVIKGVTENWNATYKWTLEKLGKKYRNQKFKCGEDNHGYSKLGKKYRNQKFKCGEDNHGYSHPRRKKLLDDYEVPIYFQDDLFQYAGEDKRPPYRWFVMGPARSGTGIHIDPLGTNPDDGDVKDDSPAVESKEFKPIDEILTNIISELGKQVENLTSVSNIKLLRTPLFEYETFVNISHTDLKPNVYEGGYKIWECTFDLLNFIKDNVAVDKLSVLDVGCGAGLLGLYTLMNGAAHVSFQDYNQEVIESLTLPNILMNTDNLEKCKFYHGDWGSLSAVIHSKFDIILTSETIYSVANYNKLLTVWCLFPTHTPKDLLKVTSAEGGKQRDEAITWFSIIYPRTQLPSWPTEWKPLELVQGPGETVFVPGGWWHVVLNLDTTVAVTQNFCSHTNFPVVYHKTIRGRPKLSKKWYRKLK**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Bifunctional arginine demethylase and lysyl-hydroxylase PSR	Dioxygenase that can both act as a histone arginine demethylase and a lysyl-hydroxylase.	confident	Q9VD28

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005506 [MF]	iron ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0033746 [MF]	histone demethylase activity (H3-R2 specific)	probable	GO:0032451, GO:0032452, GO:0003674, GO:0003824
GO:0033749 [MF]	histone demethylase activity (H4-R3 specific)	probable	GO:0032451, GO:0032452, GO:0003674, GO:0003824
GO:0018395 [BP]	peptidyl-lysine hydroxylation to 5-hydroxy-L-lysine	probable	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0018205, GO:0044237, GO:0009987, GO:0018193, GO:0043170, GO:0019538, GO:0043412, GO:0036211, GO:0008150, GO:0017185, GO:0008152, GO:0006464, GO:0018126
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0042802 [MF]	identical protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0070815 [MF]	peptidyl-lysine 5-dioxygenase activity	probable	GO:0051213, GO:0016706, GO:0016705, GO:0003824, GO:0003674, GO:0016491
GO:0070078 [BP]	histone H3-R2 demethylation	probable	GO:0008214, GO:0044699, GO:0044267, GO:0006482, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016577, GO:0016570, GO:0006996, GO:0009987, GO:0044710, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0070988, GO:0044238, GO:0051276, GO:0070077, GO:0019538, GO:0044237, GO:0043170, GO:0044763, GO:0016568, GO:0016569
GO:0070079 [BP]	histone H4-R3 demethylation	probable	GO:0008214, GO:0044699, GO:0044267, GO:0006482, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016577, GO:0016570, GO:0006996, GO:0009987, GO:0044710, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0070988, GO:0044238, GO:0051276, GO:0070077, GO:0019538, GO:0044237, GO:0043170, GO:0044763, GO:0016568, GO:0016569
GO:0003727 [MF]	single-stranded RNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K2O, chain A
Confidence level:very confident
Coverage over the Query: 12-203,381-495
View the alignment between query and template
View the model in PyMOL

Template: 3BZB, chain A
Confidence level:very confident
Coverage over the Query: 273-384
View the alignment between query and template
View the model in PyMOL

Template: 3Q7E, chain A
Confidence level:confident
Coverage over the Query: 252-421
View the alignment between query and template
View the model in PyMOL