Psyllid ID: psy11730
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 496 | ||||||
| 157117910 | 395 | phosphatidylserine receptor [Aedes aegyp | 0.389 | 0.488 | 0.603 | 3e-63 | |
| 157136728 | 289 | phosphatidylserine receptor [Aedes aegyp | 0.389 | 0.667 | 0.603 | 7e-63 | |
| 328711877 | 389 | PREDICTED: bifunctional arginine demethy | 0.364 | 0.465 | 0.626 | 2e-61 | |
| 380025056 | 392 | PREDICTED: bifunctional arginine demethy | 0.473 | 0.599 | 0.534 | 3e-60 | |
| 328781689 | 392 | PREDICTED: bifunctional arginine demethy | 0.473 | 0.599 | 0.534 | 4e-60 | |
| 340713950 | 392 | PREDICTED: bifunctional arginine demethy | 0.370 | 0.469 | 0.621 | 7e-60 | |
| 350421147 | 392 | PREDICTED: bifunctional arginine demethy | 0.370 | 0.469 | 0.621 | 8e-60 | |
| 383863665 | 392 | PREDICTED: bifunctional arginine demethy | 0.473 | 0.599 | 0.526 | 2e-59 | |
| 332027374 | 384 | Bifunctional arginine demethylase and ly | 0.473 | 0.611 | 0.522 | 7e-59 | |
| 345495333 | 392 | PREDICTED: bifunctional arginine demethy | 0.370 | 0.469 | 0.611 | 1e-58 |
| >gi|157117910|ref|XP_001653096.1| phosphatidylserine receptor [Aedes aegypti] gi|157117912|ref|XP_001653097.1| phosphatidylserine receptor [Aedes aegypti] gi|108875937|gb|EAT40162.1| AAEL008084-PA [Aedes aegypti] gi|108875938|gb|EAT40163.1| AAEL008084-PB [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 249 bits (635), Expect = 3e-63, Method: Compositional matrix adjust.
Identities = 122/202 (60%), Positives = 152/202 (75%), Gaps = 9/202 (4%)
Query: 2 VSTSETSKVLDSRARKRIKETKKRARPELNGKDAWFELGYADKFDKFKIVKENVERIHVK 61
+S +E L R RKR++E K++ARPEL K AW +L Y KFDKF+ ++NVERIHVK
Sbjct: 1 MSLNEGEVKLSHRTRKRVREVKRKARPELADKSAWVQLEYHRKFDKFREFEDNVERIHVK 60
Query: 62 DYSPQEFIEKYEKPNKPVVIKGVTENWNATYKWTLEKLGKKYRNQKFKCGEDNHGYS-KL 120
D SP+EFIE++E KPVVI+G+TE W A YKWTLE+L KKYRNQKFKCGEDN GYS K+
Sbjct: 61 DVSPREFIERFESIYKPVVIEGITEGWKAEYKWTLERLAKKYRNQKFKCGEDNDGYSVKM 120
Query: 121 GKKYRNQKFKCGEDNHGY--------SHPRRKKLLDDYEVPIYFQDDLFQYAGEDKRPPY 172
KY + + D+ H RRKKLL+DY++P+YF+DDLF++AGE++RPPY
Sbjct: 121 KMKYYIEYMRNTTDDSPLYIFDSSFGEHHRRKKLLEDYDIPLYFRDDLFKHAGEERRPPY 180
Query: 173 RWFVMGPARSGTGIHIDPLGTN 194
RWFVMGPARSGTGIHIDPLGT+
Sbjct: 181 RWFVMGPARSGTGIHIDPLGTS 202
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157136728|ref|XP_001656895.1| phosphatidylserine receptor [Aedes aegypti] gi|108869876|gb|EAT34101.1| AAEL013632-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|328711877|ref|XP_001943315.2| PREDICTED: bifunctional arginine demethylase and lysyl-hydroxylase PSR-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|380025056|ref|XP_003696297.1| PREDICTED: bifunctional arginine demethylase and lysyl-hydroxylase PSR-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328781689|ref|XP_394543.3| PREDICTED: bifunctional arginine demethylase and lysyl-hydroxylase PSR [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|340713950|ref|XP_003395496.1| PREDICTED: bifunctional arginine demethylase and lysyl-hydroxylase PSR-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350421147|ref|XP_003492749.1| PREDICTED: bifunctional arginine demethylase and lysyl-hydroxylase PSR-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383863665|ref|XP_003707300.1| PREDICTED: bifunctional arginine demethylase and lysyl-hydroxylase PSR-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|332027374|gb|EGI67457.1| Bifunctional arginine demethylase and lysyl-hydroxylase PSR [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|345495333|ref|XP_001601114.2| PREDICTED: bifunctional arginine demethylase and lysyl-hydroxylase PSR-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 496 | ||||||
| FB|FBgn0038948 | 408 | PSR "phosphatidylserine recept | 0.381 | 0.463 | 0.572 | 1.5e-108 | |
| ZFIN|ZDB-GENE-040426-17 | 403 | jmjd6 "jumonji domain containi | 0.370 | 0.456 | 0.551 | 2.4e-106 | |
| UNIPROTKB|Q6GND3 | 403 | jmjd6-a "Bifunctional arginine | 0.370 | 0.456 | 0.561 | 2.2e-105 | |
| UNIPROTKB|Q7ZX37 | 403 | jmjd6-b "Bifunctional arginine | 0.370 | 0.456 | 0.546 | 3.2e-104 | |
| UNIPROTKB|Q58DS6 | 403 | JMJD6 "Bifunctional arginine d | 0.370 | 0.456 | 0.530 | 4e-104 | |
| UNIPROTKB|E2RE42 | 414 | JMJD6 "Uncharacterized protein | 0.370 | 0.444 | 0.530 | 5.1e-104 | |
| UNIPROTKB|Q6NYC1 | 403 | JMJD6 "Bifunctional arginine d | 0.370 | 0.456 | 0.530 | 5.1e-104 | |
| UNIPROTKB|Q5R6G2 | 403 | JMJD6 "Bifunctional arginine d | 0.370 | 0.456 | 0.530 | 5.1e-104 | |
| MGI|MGI:1858910 | 403 | Jmjd6 "jumonji domain containi | 0.225 | 0.277 | 0.785 | 8.3e-104 | |
| RGD|1305395 | 403 | Jmjd6 "jumonji domain containi | 0.225 | 0.277 | 0.785 | 8.3e-104 |
| FB|FBgn0038948 PSR "phosphatidylserine receptor" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 580 (209.2 bits), Expect = 1.5e-108, Sum P(2) = 1.5e-108
Identities = 114/199 (57%), Positives = 141/199 (70%)
Query: 5 SETSKVLDSRARKRIKETKKRARPELNGKDAWFELGYADKFDKFKIVKENVERIHVKDYS 64
SE K L R+RKR +E K++ARPEL+G++AW + Y +KF+ F +N+ERI
Sbjct: 2 SEEFK-LPKRSRKRTREVKRKARPELDGENAWSAMRYCEKFEPFWDFTDNLERIEESQVP 60
Query: 65 PQEFIEKYEKPNKPVVIKGVTENWNATYKWTLEKLGKKYRNQKFKCGEDNHGYS-KLGKK 123
EFIE++E+P KPVVI+G T+ W A KWTL +L KKYRNQKFKCGEDN GYS K+ K
Sbjct: 61 ESEFIERFERPYKPVVIRGCTDGWLALEKWTLARLAKKYRNQKFKCGEDNEGYSVKMKMK 120
Query: 124 YRNQKFKCGEDNHG-Y-------SHPRRKKLLDDYEVPIYFQDDLFQYAGEDKRPPYRWF 175
Y + + D+ Y H RR+KLLDDY VP YF+DDLFQY GE++RPPYRWF
Sbjct: 121 YYVEYMQSTRDDSPLYIFDSSFGEHHRRRKLLDDYVVPKYFRDDLFQYCGENRRPPYRWF 180
Query: 176 VMGPARSGTGIHIDPLGTN 194
VMGPARSGTGIHIDPLGT+
Sbjct: 181 VMGPARSGTGIHIDPLGTS 199
|
|
| ZFIN|ZDB-GENE-040426-17 jmjd6 "jumonji domain containing 6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6GND3 jmjd6-a "Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7ZX37 jmjd6-b "Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6-B" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DS6 JMJD6 "Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RE42 JMJD6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6NYC1 JMJD6 "Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R6G2 JMJD6 "Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1858910 Jmjd6 "jumonji domain containing 6" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1305395 Jmjd6 "jumonji domain containing 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 496 | |||
| pfam02373 | 114 | pfam02373, JmjC, JmjC domain, hydroxylase | 3e-18 | |
| pfam13847 | 151 | pfam13847, Methyltransf_31, Methyltransferase doma | 9e-08 | |
| pfam13621 | 247 | pfam13621, Cupin_8, Cupin-like domain | 3e-06 | |
| pfam05175 | 170 | pfam05175, MTS, Methyltransferase small domain | 4e-06 | |
| TIGR03534 | 251 | TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) met | 5e-06 | |
| PRK14968 | 188 | PRK14968, PRK14968, putative methyltransferase; Pr | 7e-06 | |
| cd02440 | 107 | cd02440, AdoMet_MTases, S-adenosylmethionine-depen | 8e-06 | |
| smart00558 | 58 | smart00558, JmjC, A domain family that is part of | 2e-04 | |
| COG2890 | 280 | COG2890, HemK, Methylase of polypeptide chain rele | 6e-04 | |
| PRK05134 | 233 | PRK05134, PRK05134, bifunctional 3-demethylubiquin | 0.001 | |
| pfam08241 | 92 | pfam08241, Methyltransf_11, Methyltransferase doma | 0.001 | |
| COG2813 | 300 | COG2813, RsmC, 16S RNA G1207 methylase RsmC [Trans | 0.003 | |
| TIGR01983 | 224 | TIGR01983, UbiG, ubiquinone biosynthesis O-methylt | 0.004 | |
| pfam12847 | 104 | pfam12847, Methyltransf_18, Methyltransferase doma | 0.004 |
| >gnl|CDD|202224 pfam02373, JmjC, JmjC domain, hydroxylase | Back alignment and domain information |
|---|
Score = 80.0 bits (198), Expect = 3e-18
Identities = 34/124 (27%), Positives = 47/124 (37%), Gaps = 12/124 (9%)
Query: 344 KFYHGDWGSLSAVIHSKFDIILTSETIYSVANYNKL--LTVWCLFPTHTPKDLLKVTSAE 401
Y G GS + + +YS NY VW + P+ + KV S
Sbjct: 1 WLYMGMPGS-------TTPWHIEDQGLYS-INYLHFGGPKVWYIIPSEYAEKFEKVLSKH 52
Query: 402 GGKQRDEAITWFSIIYPRTQLPSWPTEWKPLELVQGPGETVFVPGGWWHVVLNLDTTVAV 461
G ++ + + + I QL VQ PGE VF GW+H V NL +A
Sbjct: 53 NGGEQPDLLLHLNTIISPKQL--LENGIPVYRFVQKPGEFVFTFPGWYHQVFNLGFNIAE 110
Query: 462 TQNF 465
NF
Sbjct: 111 AVNF 114
|
The JmjC domain belongs to the Cupin superfamily. JmjC-domain proteins may be protein hydroxylases that catalyze a novel histone modification. This is confirmed to be a hydroxylase: the human JmjC protein named Tyw5p unexpectedly acts in the biosynthesis of a hypermodified nucleoside, hydroxy-wybutosine, in tRNA-Phe by catalyzing hydroxylation. Length = 114 |
| >gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|222269 pfam13621, Cupin_8, Cupin-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|203189 pfam05175, MTS, Methyltransferase small domain | Back alignment and domain information |
|---|
| >gnl|CDD|234248 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >gnl|CDD|214721 smart00558, JmjC, A domain family that is part of the cupin metalloenzyme superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|225443 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235350 PRK05134, PRK05134, bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|225370 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|233668 TIGR01983, UbiG, ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 496 | |||
| KOG2130|consensus | 407 | 100.0 | ||
| PF13621 | 251 | Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU | 99.94 | |
| KOG2131|consensus | 427 | 99.9 | ||
| KOG2508|consensus | 437 | 99.73 | ||
| KOG2132|consensus | 355 | 99.7 | ||
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 99.49 | |
| KOG1499|consensus | 346 | 99.46 | ||
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 99.42 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 99.39 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 99.35 | |
| KOG1270|consensus | 282 | 99.34 | ||
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 99.31 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 99.3 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 99.3 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 99.3 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 99.29 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 99.28 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 99.28 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 99.28 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 99.26 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 99.25 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 99.23 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 99.22 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 99.21 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 99.2 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 99.18 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 99.17 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 99.17 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 99.15 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 99.14 | |
| PF10294 | 173 | Methyltransf_16: Putative methyltransferase; Inter | 99.14 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 99.12 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 99.12 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 99.11 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 99.1 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 99.1 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 99.1 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 99.1 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 99.09 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 99.09 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 99.07 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 99.07 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 99.05 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 99.05 | |
| KOG1540|consensus | 296 | 99.04 | ||
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 99.04 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 99.03 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 99.02 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 99.01 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 99.01 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 99.0 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 99.0 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 98.99 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 98.99 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 98.99 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 98.99 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 98.97 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 98.96 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 98.96 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 98.95 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 98.95 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 98.95 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 98.93 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 98.92 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 98.9 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 98.9 | |
| KOG1500|consensus | 517 | 98.9 | ||
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 98.89 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 98.89 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 98.88 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 98.87 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 98.87 | |
| KOG4300|consensus | 252 | 98.86 | ||
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 98.85 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 98.85 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 98.84 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 98.84 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 98.83 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 98.83 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 98.83 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 98.81 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 98.81 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 98.8 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 98.8 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 98.79 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 98.78 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 98.78 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 98.78 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 98.78 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 98.77 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 98.76 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 98.76 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 98.76 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 98.74 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 98.74 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 98.73 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 98.72 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 98.72 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 98.71 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 98.7 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 98.7 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 98.7 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 98.69 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 98.68 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 98.67 | |
| KOG1541|consensus | 270 | 98.66 | ||
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 98.66 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 98.65 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 98.65 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 98.65 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 98.64 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 98.64 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 98.64 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 98.6 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 98.6 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 98.58 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 98.57 | |
| KOG1271|consensus | 227 | 98.56 | ||
| KOG3420|consensus | 185 | 98.56 | ||
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 98.55 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 98.55 | |
| PRK04266 | 226 | fibrillarin; Provisional | 98.54 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 98.52 | |
| KOG3010|consensus | 261 | 98.52 | ||
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 98.52 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 98.51 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 98.51 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 98.51 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 98.51 | |
| KOG3191|consensus | 209 | 98.5 | ||
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 98.46 | |
| KOG2904|consensus | 328 | 98.46 | ||
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 98.46 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 98.45 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 98.45 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 98.44 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 98.44 | |
| KOG2920|consensus | 282 | 98.43 | ||
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 98.43 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 98.42 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 98.42 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 98.4 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 98.39 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 98.39 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 98.38 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 98.38 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 98.36 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 98.36 | |
| KOG1356|consensus | 889 | 98.36 | ||
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 98.36 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 98.35 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 98.35 | |
| COG3897 | 218 | Predicted methyltransferase [General function pred | 98.31 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 98.31 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 98.31 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 98.3 | |
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 98.29 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 98.28 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 98.23 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 98.22 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 98.16 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 98.12 | |
| COG0030 | 259 | KsgA Dimethyladenosine transferase (rRNA methylati | 98.12 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 98.12 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 98.08 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 98.08 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 98.07 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 98.04 | |
| PF05724 | 218 | TPMT: Thiopurine S-methyltransferase (TPMT); Inter | 98.04 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 98.04 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 98.03 | |
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 98.02 | |
| COG3963 | 194 | Phospholipid N-methyltransferase [Lipid metabolism | 98.0 | |
| KOG2187|consensus | 534 | 97.99 | ||
| KOG0820|consensus | 315 | 97.98 | ||
| PLN02366 | 308 | spermidine synthase | 97.98 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 97.96 | |
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 97.92 | |
| PLN02232 | 160 | ubiquinone biosynthesis methyltransferase | 97.89 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 97.86 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 97.85 | |
| COG2850 | 383 | Uncharacterized conserved protein [Function unknow | 97.84 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 97.82 | |
| PF02373 | 114 | JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 | 97.79 | |
| KOG1975|consensus | 389 | 97.78 | ||
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 97.76 | |
| PLN02476 | 278 | O-methyltransferase | 97.74 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 97.73 | |
| KOG1633|consensus | 776 | 97.7 | ||
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 97.7 | |
| KOG2940|consensus | 325 | 97.68 | ||
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 97.67 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 97.63 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 97.63 | |
| PF02527 | 184 | GidB: rRNA small subunit methyltransferase G; Inte | 97.6 | |
| KOG3201|consensus | 201 | 97.59 | ||
| PF05891 | 218 | Methyltransf_PK: AdoMet dependent proline di-methy | 97.57 | |
| KOG2361|consensus | 264 | 97.55 | ||
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 97.54 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 97.52 | |
| COG0357 | 215 | GidB Predicted S-adenosylmethionine-dependent meth | 97.51 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 97.5 | |
| COG4076 | 252 | Predicted RNA methylase [General function predicti | 97.49 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 97.46 | |
| COG0220 | 227 | Predicted S-adenosylmethionine-dependent methyltra | 97.44 | |
| PLN02823 | 336 | spermine synthase | 97.39 | |
| COG0116 | 381 | Predicted N6-adenine-specific DNA methylase [DNA r | 97.36 | |
| PF13679 | 141 | Methyltransf_32: Methyltransferase domain | 97.36 | |
| COG1041 | 347 | Predicted DNA modification methylase [DNA replicat | 97.35 | |
| PLN02589 | 247 | caffeoyl-CoA O-methyltransferase | 97.33 | |
| PF06080 | 204 | DUF938: Protein of unknown function (DUF938); Inte | 97.31 | |
| PF02384 | 311 | N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T | 97.31 | |
| COG2521 | 287 | Predicted archaeal methyltransferase [General func | 97.29 | |
| TIGR01444 | 143 | fkbM_fam methyltransferase, FkbM family. Members o | 97.25 | |
| KOG1661|consensus | 237 | 97.24 | ||
| PF05219 | 265 | DREV: DREV methyltransferase; InterPro: IPR007884 | 97.23 | |
| PRK11760 | 357 | putative 23S rRNA C2498 ribose 2'-O-ribose methylt | 97.18 | |
| KOG2899|consensus | 288 | 97.16 | ||
| PF05971 | 299 | Methyltransf_10: Protein of unknown function (DUF8 | 97.13 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 97.07 | |
| PRK10611 | 287 | chemotaxis methyltransferase CheR; Provisional | 97.04 | |
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 97.0 | |
| COG0421 | 282 | SpeE Spermidine synthase [Amino acid transport and | 96.96 | |
| COG1189 | 245 | Predicted rRNA methylase [Translation, ribosomal s | 96.92 | |
| KOG2793|consensus | 248 | 96.87 | ||
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 96.72 | |
| KOG1709|consensus | 271 | 96.72 | ||
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 96.54 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 96.51 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 96.51 | |
| smart00558 | 57 | JmjC A domain family that is part of the cupin met | 96.5 | |
| KOG2730|consensus | 263 | 96.49 | ||
| PF09243 | 274 | Rsm22: Mitochondrial small ribosomal subunit Rsm22 | 96.46 | |
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 96.34 | |
| PF01739 | 196 | CheR: CheR methyltransferase, SAM binding domain; | 96.34 | |
| PF08007 | 319 | Cupin_4: Cupin superfamily protein; InterPro: IPR0 | 96.24 | |
| PF04816 | 205 | DUF633: Family of unknown function (DUF633) ; Inte | 96.2 | |
| PHA01634 | 156 | hypothetical protein | 96.15 | |
| COG0500 | 257 | SmtA SAM-dependent methyltransferases [Secondary m | 96.14 | |
| KOG2915|consensus | 314 | 96.12 | ||
| COG1352 | 268 | CheR Methylase of chemotaxis methyl-accepting prot | 96.04 | |
| COG0293 | 205 | FtsJ 23S rRNA methylase [Translation, ribosomal st | 96.02 | |
| KOG1331|consensus | 293 | 96.0 | ||
| PF04445 | 234 | SAM_MT: Putative SAM-dependent methyltransferase; | 95.93 | |
| KOG1269|consensus | 364 | 95.9 | ||
| PF01269 | 229 | Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr | 95.72 | |
| PF05148 | 219 | Methyltransf_8: Hypothetical methyltransferase; In | 95.67 | |
| PF01861 | 243 | DUF43: Protein of unknown function DUF43; InterPro | 95.63 | |
| KOG3045|consensus | 325 | 95.58 | ||
| PF01728 | 181 | FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 | 95.53 | |
| PF12147 | 311 | Methyltransf_20: Putative methyltransferase; Inter | 95.41 | |
| COG4262 | 508 | Predicted spermidine synthase with an N-terminal m | 95.25 | |
| TIGR00006 | 305 | S-adenosyl-methyltransferase MraW. Genetics paper | 95.16 | |
| PF01555 | 231 | N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th | 94.83 | |
| COG2384 | 226 | Predicted SAM-dependent methyltransferase [General | 94.78 | |
| KOG1501|consensus | 636 | 94.58 | ||
| PRK11524 | 284 | putative methyltransferase; Provisional | 94.55 | |
| KOG4058|consensus | 199 | 94.52 | ||
| PRK00536 | 262 | speE spermidine synthase; Provisional | 94.46 | |
| PF11968 | 219 | DUF3321: Putative methyltransferase (DUF3321); Int | 94.34 | |
| KOG3987|consensus | 288 | 94.11 | ||
| PF07942 | 270 | N2227: N2227-like protein; InterPro: IPR012901 Thi | 94.09 | |
| PF07757 | 112 | AdoMet_MTase: Predicted AdoMet-dependent methyltra | 93.89 | |
| PF07091 | 251 | FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: | 93.83 | |
| KOG4589|consensus | 232 | 93.54 | ||
| PRK13699 | 227 | putative methylase; Provisional | 93.53 | |
| TIGR00675 | 315 | dcm DNA-methyltransferase (dcm). All proteins in t | 93.4 | |
| TIGR03439 | 319 | methyl_EasF probable methyltransferase domain, Eas | 93.24 | |
| PF00145 | 335 | DNA_methylase: C-5 cytosine-specific DNA methylase | 93.03 | |
| KOG2078|consensus | 495 | 92.97 | ||
| KOG1227|consensus | 351 | 92.94 | ||
| KOG2671|consensus | 421 | 92.92 | ||
| KOG1663|consensus | 237 | 92.68 | ||
| KOG2352|consensus | 482 | 92.49 | ||
| KOG3178|consensus | 342 | 92.12 | ||
| PF01189 | 283 | Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR | 92.01 | |
| COG0270 | 328 | Dcm Site-specific DNA methylase [DNA replication, | 91.62 | |
| KOG3115|consensus | 249 | 91.23 | ||
| COG1889 | 231 | NOP1 Fibrillarin-like rRNA methylase [Translation, | 91.22 | |
| COG0286 | 489 | HsdM Type I restriction-modification system methyl | 90.74 | |
| COG3129 | 292 | Predicted SAM-dependent methyltransferase [General | 90.08 | |
| COG0144 | 355 | Sun tRNA and rRNA cytosine-C5-methylases [Translat | 90.08 | |
| PF01795 | 310 | Methyltransf_5: MraW methylase family; InterPro: I | 89.83 | |
| COG1867 | 380 | TRM1 N2,N2-dimethylguanosine tRNA methyltransferas | 88.94 | |
| PF13578 | 106 | Methyltransf_24: Methyltransferase domain; PDB: 3S | 88.77 | |
| PF04672 | 267 | Methyltransf_19: S-adenosyl methyltransferase; Int | 88.53 | |
| KOG2651|consensus | 476 | 88.5 | ||
| PRK10458 | 467 | DNA cytosine methylase; Provisional | 88.4 | |
| COG0275 | 314 | Predicted S-adenosylmethionine-dependent methyltra | 88.08 | |
| COG1568 | 354 | Predicted methyltransferases [General function pre | 88.02 | |
| PF11599 | 246 | AviRa: RRNA methyltransferase AviRa; InterPro: IPR | 87.72 | |
| PF02005 | 377 | TRM: N2,N2-dimethylguanosine tRNA methyltransferas | 87.5 | |
| PF03059 | 276 | NAS: Nicotianamine synthase protein; InterPro: IPR | 86.91 | |
| PF02636 | 252 | Methyltransf_28: Putative S-adenosyl-L-methionine- | 86.18 | |
| COG1565 | 370 | Uncharacterized conserved protein [Function unknow | 86.1 | |
| KOG1596|consensus | 317 | 85.71 | ||
| PF06560 | 182 | GPI: Glucose-6-phosphate isomerase (GPI); InterPro | 84.29 | |
| PF11899 | 380 | DUF3419: Protein of unknown function (DUF3419); In | 84.04 | |
| KOG1122|consensus | 460 | 82.06 |
| >KOG2130|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-79 Score=577.92 Aligned_cols=311 Identities=56% Similarity=1.011 Sum_probs=294.4
Q ss_pred ccccchHHHHhhHHhhhcCCCCCCCcccccccCcccccccc-ccCCCceeeecCCCCCHHHHHHHhcCCCCcEEEecCCC
Q psy11730 8 SKVLDSRARKRIKETKKRARPELNGKDAWFELGYADKFDKF-KIVKENVERIHVKDYSPQEFIEKYEKPNKPVVIKGVTE 86 (496)
Q Consensus 8 ~~~~~~~~~~~~~~~k~~~r~~~~~~~~w~~~~~~~~~~~~-~~~~~~I~Ri~~~~ls~eeF~~~y~~~~~PvVi~g~~~ 86 (496)
...+++++.+|++++|+++||+|....+|...+|++.|.+. +...++++|+++.++|.+||+++|.+|++||||+|+++
T Consensus 6 y~~~n~~~~kr~~~~kr~arpel~~~~~w~~~~y~e~f~~~~~~~~dn~~r~~~~~isveeF~~~ferp~kPVll~g~~D 85 (407)
T KOG2130|consen 6 YILCNHEPLKRSLELKRKARPELYKMSDWLYKRYYESFTLLDPFFFDNGNRERRRNISVEEFIERFERPYKPVLLSGLTD 85 (407)
T ss_pred eeecCcchHHHHHHHHHhcChhhhhhhhHHHHHHHHhccccCccccccchhhhhcCCCHHHHHHHhcccCCceEeecccc
Confidence 45688999999999999999999999999999999999764 45889999999999999999999999999999999999
Q ss_pred CCcCCCCCCHHHHHhhcCCeeEEeeecCCCcc-ccCHHHHHHHhhcCCCC-CCCCcc-----ccc--cccccCCCCCCCc
Q psy11730 87 NWNATYKWTLEKLGKKYRNQKFKCGEDNHGYS-KLGKKYRNQKFKCGEDN-HGYSHP-----RRK--KLLDDYEVPIYFQ 157 (496)
Q Consensus 87 ~WpA~~~Wt~~~L~~~~g~~~v~v~~~~~~~~-~m~~~~f~~~~~~~~~~-p~y~~~-----~~~--~L~~d~~~P~~f~ 157 (496)
+|||.+|||.++|.++|||++|+|+++++|++ +|+|++|++||+++.|+ |+|+++ +.| .|.+||.||+||+
T Consensus 86 gW~A~ekWT~drLskkyrnq~Fkcged~~gnsv~MKmkyY~~Ym~~~RddsPLYiFDssFgE~~~~rkLl~dY~VPk~F~ 165 (407)
T KOG2130|consen 86 GWPASEKWTLDRLSKKYRNQKFKCGEDNNGNSVKMKMKYYIEYMKSTRDDSPLYIFDSSFGEHAPRRKLLEDYSVPKYFR 165 (407)
T ss_pred CCchhhhhhHHHHHHHhcCccccccccCCCcceeeeHHHHHHHHhccccCCCeEEecchhhcccchhhhhhhcCcchhhh
Confidence 99999999999999999999999999999999 99999999999999998 988865 234 8999999999999
Q ss_pred hhhhcccCCCCCCCccceEecCCCCccccccCCCCCCCcccccCCCCCccccCCCCChhHHHHHHHHHhccccccccccc
Q psy11730 158 DDLFQYAGEDKRPPYRWFVMGPARSGTGIHIDPLGTNPDDGDVKDDSPAVESKEFKPIDEILTNIISELGKQVENLTSVS 237 (496)
Q Consensus 158 ~d~~~~~~~~~~p~~~w~~iG~~gs~T~lH~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~ 237 (496)
+|+|+++++++|||||||+|||++|||.+|+||.+++|||+-|+|.
T Consensus 166 dDlF~y~g~e~RPpyRWfvmGParSGtsiHIDPlgTSAWNtll~Gh---------------------------------- 211 (407)
T KOG2130|consen 166 DDLFQYLGEERRPPYRWFVMGPARSGTSIHIDPLGTSAWNTLLQGH---------------------------------- 211 (407)
T ss_pred HHHHHhcCcccCCCceeEEecCCCCCceeEECCcchHHHHHHhhcc----------------------------------
Confidence 9999999999999999999999999999999999999944444432
Q ss_pred cchhcccCCccccceeecccccCCCccccCceeeecchHHHHHHHHhCCCCCCCeEEEecCcCCHHHHHHHHccCCeEEE
Q psy11730 238 NIKLLRTPLFEYETFVNISHTDLKPNVYEGGYKIWECTFDLLNFIKDNVAVDKLSVLDVGCGAGLLGLYTLMNGAAHVSF 317 (496)
Q Consensus 238 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~VLDlGcGtG~~~~~la~~~~~~v~g 317 (496)
T Consensus 212 -------------------------------------------------------------------------------- 211 (407)
T KOG2130|consen 212 -------------------------------------------------------------------------------- 211 (407)
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred EeCCHHHHHHhcCcccccccCCCCceEEEecccCCccccCCCceeEEEEccccccccchHhHhheeeecCCCCCcccEEE
Q psy11730 318 QDYNQEVIESLTLPNILMNTDNLEKCKFYHGDWGSLSAVIHSKFDIILTSETIYSVANYNKLLTVWCLFPTHTPKDLLKV 397 (496)
Q Consensus 318 iD~s~~~i~~a~~~~~~~~~~~~~~v~~~~~d~~~~~~~~~~~fD~Ii~~~~l~~~~~~~~~~~~~~l~p~~~~~~~~~~ 397 (496)
+.|+|||++.+..++.+
T Consensus 212 ---------------------------------------------------------------KrW~LfPp~~p~~lvkv 228 (407)
T KOG2130|consen 212 ---------------------------------------------------------------KRWVLFPPGTPPELVKV 228 (407)
T ss_pred ---------------------------------------------------------------ceeEEcCCCCCCCceee
Confidence 78999999999999999
Q ss_pred eeccCCcccccccchhhHhcCCCCCCCCCCCCCchhhhccCCceeeeCCcceEEEEeeeeeEEEeecccCCCChhhHHHH
Q psy11730 398 TSAEGGKQRDEAITWFSIIYPRTQLPSWPTEWKPLELVQGPGETVFVPGGWWHVVLNLDTTVAVTQNFCSHTNFPVVYHK 477 (496)
Q Consensus 398 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~e~~~~~Ge~l~iP~gWwh~v~~l~~~i~v~~~~~~~~~~~~~~~~ 477 (496)
....++....+.+.||..+|+.+++|.||.+.+|+||+|+|||++|+|+||||.|+|+++|||||||||+.+||+-||||
T Consensus 229 ~~~e~g~~~de~itwf~~~y~rt~~Pswp~E~kPIEc~q~pGEt~fVP~GWWHvVlNle~TIAiTqNf~s~eNf~~Vw~k 308 (407)
T KOG2130|consen 229 TVDEGGKQPDEIITWFSTIYPRTQLPSWPDEYKPIECLQKPGETMFVPSGWWHVVLNLEPTIAITQNFASKENFPFVWHK 308 (407)
T ss_pred cccccCCCCcceechhhhccccccCCCCccccCCceeeecCCceEEecCCeEEEEeccCceeeeeeccccccCCceeeec
Confidence 99999989999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhcCCchhhHHHHHHHhc
Q psy11730 478 TIRGRPKLSKKWYRKLKT 495 (496)
Q Consensus 478 ~~~~~~~~~~~~~~~~~~ 495 (496)
|++||||+|++|++.|+.
T Consensus 309 tv~Grpkls~~w~~~L~~ 326 (407)
T KOG2130|consen 309 TVRGRPKLSRKWARLLAL 326 (407)
T ss_pred ccCCCcchhhHHHHHHhh
Confidence 999999999999999975
|
|
| >PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A | Back alignment and domain information |
|---|
| >KOG2131|consensus | Back alignment and domain information |
|---|
| >KOG2508|consensus | Back alignment and domain information |
|---|
| >KOG2132|consensus | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG1499|consensus | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >KOG1270|consensus | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1540|consensus | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG1500|consensus | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >KOG4300|consensus | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1541|consensus | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >KOG1271|consensus | Back alignment and domain information |
|---|
| >KOG3420|consensus | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3010|consensus | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3191|consensus | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2904|consensus | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >KOG2920|consensus | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >KOG1356|consensus | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG3897 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
| >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG2187|consensus | Back alignment and domain information |
|---|
| >KOG0820|consensus | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >PLN02232 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2850 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] | Back alignment and domain information |
|---|
| >KOG1975|consensus | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >KOG1633|consensus | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2940|consensus | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G | Back alignment and domain information |
|---|
| >KOG3201|consensus | Back alignment and domain information |
|---|
| >PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like | Back alignment and domain information |
|---|
| >KOG2361|consensus | Back alignment and domain information |
|---|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4076 Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13679 Methyltransf_32: Methyltransferase domain | Back alignment and domain information |
|---|
| >COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PLN02589 caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 | Back alignment and domain information |
|---|
| >COG2521 Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01444 fkbM_fam methyltransferase, FkbM family | Back alignment and domain information |
|---|
| >KOG1661|consensus | Back alignment and domain information |
|---|
| >PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes | Back alignment and domain information |
|---|
| >PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2899|consensus | Back alignment and domain information |
|---|
| >PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >PRK10611 chemotaxis methyltransferase CheR; Provisional | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2793|consensus | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG1709|consensus | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >smart00558 JmjC A domain family that is part of the cupin metalloenzyme superfamily | Back alignment and domain information |
|---|
| >KOG2730|consensus | Back alignment and domain information |
|---|
| >PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors | Back alignment and domain information |
|---|
| >PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PHA01634 hypothetical protein | Back alignment and domain information |
|---|
| >COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >KOG2915|consensus | Back alignment and domain information |
|---|
| >COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1331|consensus | Back alignment and domain information |
|---|
| >PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG1269|consensus | Back alignment and domain information |
|---|
| >PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] | Back alignment and domain information |
|---|
| >PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases | Back alignment and domain information |
|---|
| >PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised | Back alignment and domain information |
|---|
| >KOG3045|consensus | Back alignment and domain information |
|---|
| >PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes | Back alignment and domain information |
|---|
| >PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00006 S-adenosyl-methyltransferase MraW | Back alignment and domain information |
|---|
| >PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases | Back alignment and domain information |
|---|
| >COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1501|consensus | Back alignment and domain information |
|---|
| >PRK11524 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG4058|consensus | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein | Back alignment and domain information |
|---|
| >KOG3987|consensus | Back alignment and domain information |
|---|
| >PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] | Back alignment and domain information |
|---|
| >PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A | Back alignment and domain information |
|---|
| >KOG4589|consensus | Back alignment and domain information |
|---|
| >PRK13699 putative methylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00675 dcm DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >TIGR03439 methyl_EasF probable methyltransferase domain, EasF family | Back alignment and domain information |
|---|
| >PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 | Back alignment and domain information |
|---|
| >KOG2078|consensus | Back alignment and domain information |
|---|
| >KOG1227|consensus | Back alignment and domain information |
|---|
| >KOG2671|consensus | Back alignment and domain information |
|---|
| >KOG1663|consensus | Back alignment and domain information |
|---|
| >KOG2352|consensus | Back alignment and domain information |
|---|
| >KOG3178|consensus | Back alignment and domain information |
|---|
| >PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins | Back alignment and domain information |
|---|
| >COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3115|consensus | Back alignment and domain information |
|---|
| >COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria | Back alignment and domain information |
|---|
| >COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D | Back alignment and domain information |
|---|
| >PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >KOG2651|consensus | Back alignment and domain information |
|---|
| >PRK10458 DNA cytosine methylase; Provisional | Back alignment and domain information |
|---|
| >COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1568 Predicted methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes | Back alignment and domain information |
|---|
| >PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 | Back alignment and domain information |
|---|
| >PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 | Back alignment and domain information |
|---|
| >PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >COG1565 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1596|consensus | Back alignment and domain information |
|---|
| >PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 | Back alignment and domain information |
|---|
| >PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG1122|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 496 | ||||
| 3ld8_A | 334 | Structure Of Jmjd6 And Fab Fragments Length = 334 | 3e-52 | ||
| 3k2o_A | 336 | Structure Of An Oxygenase Length = 336 | 3e-52 |
| >pdb|3LD8|A Chain A, Structure Of Jmjd6 And Fab Fragments Length = 334 | Back alignment and structure |
|
| >pdb|3K2O|A Chain A, Structure Of An Oxygenase Length = 336 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 496 | |||
| 3k2o_A | 336 | Bifunctional arginine demethylase and lysyl-hydro | 1e-54 | |
| 3k2o_A | 336 | Bifunctional arginine demethylase and lysyl-hydro | 5e-32 | |
| 3uyj_A | 248 | Lysine-specific demethylase 8; jellyroll-like all | 4e-23 | |
| 3uyj_A | 248 | Lysine-specific demethylase 8; jellyroll-like all | 9e-16 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 8e-15 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 2e-07 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 2e-14 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 5e-10 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 2e-13 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 1e-06 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 3e-13 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 5e-07 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 9e-12 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 3e-04 | |
| 3k3o_A | 371 | PHF8, PHD finger protein 8; histone demethylase, c | 1e-11 | |
| 3k3o_A | 371 | PHF8, PHD finger protein 8; histone demethylase, c | 8e-06 | |
| 3pua_A | 392 | GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe | 4e-11 | |
| 3pua_A | 392 | GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe | 3e-07 | |
| 3kv9_A | 397 | JMJC domain-containing histone demethylation prote | 5e-11 | |
| 3kv9_A | 397 | JMJC domain-containing histone demethylation prote | 4e-09 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 3e-10 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 1e-05 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 2e-09 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 1e-06 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 2e-06 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 2e-06 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 2e-05 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 6e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-05 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 1e-04 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 2e-04 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 5e-04 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 6e-04 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 7e-04 |
| >3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Length = 336 | Back alignment and structure |
|---|
Score = 185 bits (471), Expect = 1e-54
Identities = 101/194 (52%), Positives = 129/194 (66%), Gaps = 10/194 (5%)
Query: 11 LDSRARKRIKETKKRARPELNGKDAWFELGYADKFD-KFKIVKENVERIHVKDYSPQEFI 69
++ +++KRI+E K+ ARPEL W Y + F V +NVER S +EF+
Sbjct: 2 MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFV 61
Query: 70 EKYEKPNKPVVIKGVTENWNATYKWTLEKLGKKYRNQKFKCGEDNHGYS---KLG----- 121
E+YE+P KPVV+ E W+A KWTLE+L +KYRNQKFKCGEDN GYS K+
Sbjct: 62 ERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEY 121
Query: 122 -KKYRNQKFKCGEDNHGYSHPRRKKLLDDYEVPIYFQDDLFQYAGEDKRPPYRWFVMGPA 180
+ R+ D+ HP+R+KLL+DY+VP +F DDLFQYAGE +RPPYRWFVMGP
Sbjct: 122 MESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPP 181
Query: 181 RSGTGIHIDPLGTN 194
RSGTGIHIDPLGT+
Sbjct: 182 RSGTGIHIDPLGTS 195
|
| >3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Length = 336 | Back alignment and structure |
|---|
| >3uyj_A Lysine-specific demethylase 8; jellyroll-like all beta fold, nuclear, oxidored; HET: AKG; 2.35A {Homo sapiens} PDB: 4aap_A* Length = 248 | Back alignment and structure |
|---|
| >3uyj_A Lysine-specific demethylase 8; jellyroll-like all beta fold, nuclear, oxidored; HET: AKG; 2.35A {Homo sapiens} PDB: 4aap_A* Length = 248 | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... Length = 349 | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... Length = 349 | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* Length = 338 | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* Length = 338 | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 | Back alignment and structure |
|---|
| >3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* Length = 371 | Back alignment and structure |
|---|
| >3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* Length = 371 | Back alignment and structure |
|---|
| >3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* Length = 392 | Back alignment and structure |
|---|
| >3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* Length = 392 | Back alignment and structure |
|---|
| >3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* Length = 397 | Back alignment and structure |
|---|
| >3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* Length = 397 | Back alignment and structure |
|---|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A Length = 451 | Back alignment and structure |
|---|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A Length = 451 | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Length = 281 | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Length = 375 | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Length = 194 | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Length = 205 | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Length = 207 | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Length = 200 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 496 | |||
| 3k2o_A | 336 | Bifunctional arginine demethylase and lysyl-hydro | 100.0 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 100.0 | |
| 4gjz_A | 235 | Lysine-specific demethylase 8; JMJC, beta barrel, | 100.0 | |
| 3k3o_A | 371 | PHF8, PHD finger protein 8; histone demethylase, c | 99.97 | |
| 3pua_A | 392 | GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe | 99.97 | |
| 3kv9_A | 397 | JMJC domain-containing histone demethylation prote | 99.97 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 99.96 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 99.96 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 99.96 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 99.94 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 99.8 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 99.53 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 99.49 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 99.4 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 99.34 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 99.32 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 99.3 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 99.29 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 99.28 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 99.28 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 99.28 | |
| 2ypd_A | 392 | Probable JMJC domain-containing histone demethyla | 99.28 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 99.27 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 99.27 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 99.27 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 99.26 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 99.26 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 99.26 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 99.24 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 99.24 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 99.24 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 99.23 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 99.23 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 99.22 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 99.22 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 99.21 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 99.21 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 99.21 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 99.2 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 99.2 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 99.18 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 99.18 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 99.18 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 99.17 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 99.17 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 99.17 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 99.17 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 99.17 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 99.17 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 99.17 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 99.16 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 99.16 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 99.15 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 99.15 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 99.15 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 99.15 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 99.14 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 99.14 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 99.13 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 99.13 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 99.13 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 99.12 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 99.12 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 99.12 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 99.12 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 99.12 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 99.12 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 99.11 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 99.11 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 99.11 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 99.11 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 99.11 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 99.11 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 99.11 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 99.11 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 99.1 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 99.1 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 99.1 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 99.1 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 99.1 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 99.09 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 99.09 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 99.09 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 99.08 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 99.07 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 99.06 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 99.06 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 99.06 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 99.06 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 99.06 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 99.05 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 99.05 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 99.05 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 99.04 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 99.04 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 99.04 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 99.04 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 99.04 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 99.03 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 99.03 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 99.03 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 99.03 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 99.02 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 99.02 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 99.02 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 99.01 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 99.01 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 99.0 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 99.0 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 99.0 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 98.99 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 98.99 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 98.99 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 98.99 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 98.98 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 98.97 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 98.97 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 98.97 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 98.97 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 98.97 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 98.97 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 98.96 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 98.95 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 98.95 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 98.95 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 98.95 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 98.95 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 98.95 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 98.94 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 98.94 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 98.93 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 98.93 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 98.93 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 98.93 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 98.92 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 98.92 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 98.92 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 98.92 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 98.91 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 98.91 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 98.9 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 98.89 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 98.89 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 98.88 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 98.88 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 98.88 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 98.87 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 98.87 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 98.87 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 98.86 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 98.85 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 98.85 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 98.85 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 98.84 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 98.83 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 98.83 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 98.83 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 98.83 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 98.83 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 98.82 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 98.82 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 98.81 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 98.81 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 98.81 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 98.81 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 98.8 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 98.8 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 98.8 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 98.8 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 98.8 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 98.8 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 98.79 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 98.78 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 98.78 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 98.78 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 98.77 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 98.77 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 98.76 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 98.75 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 98.75 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 98.74 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 98.74 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 98.74 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 98.73 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 98.73 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 98.71 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 98.71 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 98.71 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 98.71 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 98.71 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 98.71 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 98.7 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 98.7 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 98.7 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 98.7 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 98.69 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 98.69 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 98.69 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 98.69 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 98.69 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 98.68 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 98.68 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 98.67 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 98.67 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 98.67 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 98.67 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 98.66 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 98.66 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 98.66 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 98.66 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 98.65 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 98.65 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 98.65 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 98.65 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 98.65 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 98.65 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 98.65 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 98.64 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 98.64 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 98.63 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 98.63 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 98.63 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 98.62 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 98.62 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 98.61 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 98.6 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 98.6 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 98.6 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 98.6 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 98.6 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 98.59 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 98.59 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 98.58 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 98.58 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 98.58 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 98.58 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 98.57 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 98.56 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 98.56 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 98.56 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 98.55 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 98.55 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 98.55 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 98.54 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 98.54 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 98.54 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 98.54 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 98.53 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 98.53 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 98.52 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 98.52 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 98.52 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 98.52 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 98.52 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 98.51 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 98.51 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 98.5 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 98.5 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 98.49 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 98.49 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 98.48 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 98.48 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 98.48 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 98.48 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 98.48 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 98.47 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 98.47 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 98.46 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 98.45 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 98.41 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 98.41 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 98.4 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 98.37 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 98.37 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 98.35 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 98.34 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 98.34 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 98.29 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 98.27 | |
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 98.26 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 98.25 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 98.23 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 98.22 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 98.18 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 98.08 | |
| 4gqb_A | 637 | Protein arginine N-methyltransferase 5; TIM barrel | 98.08 | |
| 2k4m_A | 153 | TR8_protein, UPF0146 protein MTH_1000; alpha+beta, | 98.0 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 97.87 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 97.85 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 97.81 | |
| 2xxz_A | 332 | Lysine-specific demethylase 6B; oxidoreductase, hi | 97.8 | |
| 3s1s_A | 878 | Restriction endonuclease bpusi; PD--(D/E)XK cataly | 97.79 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 97.74 | |
| 3ua3_A | 745 | Protein arginine N-methyltransferase 5; TIM-barrel | 97.73 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 97.67 | |
| 3evf_A | 277 | RNA-directed RNA polymerase NS5; NS5 methyltransfe | 97.59 | |
| 3gcz_A | 282 | Polyprotein; flavivirus, RNA capping, methyltransf | 97.57 | |
| 3avr_A | 531 | Lysine-specific demethylase 6A; cupin superfamily, | 97.56 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 97.32 | |
| 4auk_A | 375 | Ribosomal RNA large subunit methyltransferase M; Y | 97.32 | |
| 3cvo_A | 202 | Methyltransferase-like protein of unknown functio; | 97.31 | |
| 3p8z_A | 267 | Mtase, non-structural protein 5; methyltransferase | 97.15 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 97.13 | |
| 3eld_A | 300 | Methyltransferase; flavivirus, RNA capping, guanyl | 96.96 | |
| 3lkz_A | 321 | Non-structural protein 5; flavivirus, methyltransf | 96.87 | |
| 2oo3_A | 283 | Protein involved in catabolism of external DNA; st | 96.85 | |
| 3tka_A | 347 | Ribosomal RNA small subunit methyltransferase H; H | 96.79 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 96.61 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 96.56 | |
| 2qy6_A | 257 | UPF0209 protein YFCK; structural genomics, unknown | 96.55 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 96.5 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 96.48 | |
| 3ufb_A | 530 | Type I restriction-modification system methyltran | 96.45 | |
| 2efj_A | 384 | 3,7-dimethylxanthine methyltransferase; SAM-depend | 96.4 | |
| 1i4w_A | 353 | Mitochondrial replication protein MTF1; mitochondr | 96.26 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 96.2 | |
| 2px2_A | 269 | Genome polyprotein [contains: capsid protein C (co | 96.02 | |
| 3ubt_Y | 331 | Modification methylase HAEIII; protein-DNA complex | 95.94 | |
| 3b5i_A | 374 | S-adenosyl-L-methionine:salicylic acid carboxyl me | 95.78 | |
| 3c6k_A | 381 | Spermine synthase; spermidine aminopropyltransfera | 95.53 | |
| 1m6e_X | 359 | S-adenosyl-L-methionnine:salicylic acid carboxyl m | 95.25 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 94.95 | |
| 4h0n_A | 333 | DNMT2; SAH binding, transferase; HET: SAH; 2.71A { | 94.84 | |
| 4ask_A | 510 | Lysine-specific demethylase 6B; oxidoreductase, KD | 94.45 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 94.04 | |
| 1boo_A | 323 | Protein (N-4 cytosine-specific methyltransferase P | 93.72 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 93.64 | |
| 2wk1_A | 282 | NOVP; transferase, O-methyltransferase, novobiocin | 93.12 | |
| 2py6_A | 409 | Methyltransferase FKBM; YP_546752.1, structural ge | 92.85 | |
| 3r24_A | 344 | NSP16, 2'-O-methyl transferase; methyltransferase, | 92.03 | |
| 1eg2_A | 319 | Modification methylase RSRI; rossmann fold, exocyc | 91.81 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 90.19 | |
| 4ft4_B | 784 | DNA (cytosine-5)-methyltransferase 1; chromodomain | 86.38 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 83.87 | |
| 4dkj_A | 403 | Cytosine-specific methyltransferase; CG-specificit | 82.33 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 82.17 |
| >3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=6e-62 Score=488.90 Aligned_cols=308 Identities=62% Similarity=1.138 Sum_probs=266.4
Q ss_pred cchHHHHhhHHhhhcCCCCCCCcccccccCcccccccccc-CCCceeeecCCCCCHHHHHHHhcCCCCcEEEecCCCCCc
Q psy11730 11 LDSRARKRIKETKKRARPELNGKDAWFELGYADKFDKFKI-VKENVERIHVKDYSPQEFIEKYEKPNKPVVIKGVTENWN 89 (496)
Q Consensus 11 ~~~~~~~~~~~~k~~~r~~~~~~~~w~~~~~~~~~~~~~~-~~~~I~Ri~~~~ls~eeF~~~y~~~~~PvVi~g~~~~Wp 89 (496)
|++|++|||++||+|+||||..+.+|.+++|++++..++. ..++|+||+++.+|+++|.++|+.+++||||+|++.+||
T Consensus 2 ~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~I~Ri~~~~lS~eeF~~~y~~~~~PvVi~g~~~~Wp 81 (336)
T 3k2o_A 2 MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNAQEGWS 81 (336)
T ss_dssp CCHHHHHHHHHHHHHHCTTCCSHHHHHTTCHHHHCCCCGGGCCCCCCEEEGGGCCHHHHHHHTTTTTCCEEEESTTTTCT
T ss_pred CchHHHHHHHHHHHhcCccccccccccccchhhhhhhchhhcCCCCCEecCCCCCHHHHHHHhhccCCCEEEeCCcCCCh
Confidence 7899999999999999999998899999999999987764 789999999999999999999999999999999999999
Q ss_pred CCCCCCHHHHHhhcCCeeEEeeecCCCcc-ccCHHHHHHHhhcCCCC-CCCCcc-------ccccccccCCCCCCCchhh
Q psy11730 90 ATYKWTLEKLGKKYRNQKFKCGEDNHGYS-KLGKKYRNQKFKCGEDN-HGYSHP-------RRKKLLDDYEVPIYFQDDL 160 (496)
Q Consensus 90 A~~~Wt~~~L~~~~g~~~v~v~~~~~~~~-~m~~~~f~~~~~~~~~~-p~y~~~-------~~~~L~~d~~~P~~f~~d~ 160 (496)
|+++||.+||+++||+..|+|+..+.++. +|+|++|++++.+..++ |+|+++ ..|+|.+||.+|++|.+|+
T Consensus 82 A~~~Wt~~yL~~~~G~~~V~v~~~~~~~~~~m~~~~fl~~~~~~~~~~~lYL~d~~~~e~~~~p~L~~dy~~P~~f~~d~ 161 (336)
T 3k2o_A 82 AQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDL 161 (336)
T ss_dssp HHHHCSHHHHHHHSTTCEEEEEECTTSCEEEEEHHHHHHHHHHCCCSSCCCEEESCGGGSTTGGGGGGGCCCCGGGCCCG
T ss_pred hHhhhhHHHHHHHhCCceEEEEecCCCceeeecHHHHHHHHHhcCCCCCceEecccccccccchhHHHhcCCCcccccch
Confidence 99999999999999999999998777777 99999999999988776 888753 3589999999999999999
Q ss_pred hcccCCCCCCCccceEecCCCCccccccCCCCCCCcccccCCCCCccccCCCCChhHHHHHHHHHhccccccccccccch
Q psy11730 161 FQYAGEDKRPPYRWFVMGPARSGTGIHIDPLGTNPDDGDVKDDSPAVESKEFKPIDEILTNIISELGKQVENLTSVSNIK 240 (496)
Q Consensus 161 ~~~~~~~~~p~~~w~~iG~~gs~T~lH~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~ 240 (496)
|++.++..+|+++|+|||++||+|++|+|++++++|++++.|+
T Consensus 162 ~~~~~~~~~p~~~~~~~G~~gs~t~~H~D~~~~~~~~~~v~G~------------------------------------- 204 (336)
T 3k2o_A 162 FQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGH------------------------------------- 204 (336)
T ss_dssp GGGGCTTTSCCCEEEEEECTTCEEEEECCGGGCEEEEEEEESC-------------------------------------
T ss_pred hhhcccccCCCceEEEECCCCccCCcccCCCccceeeEEEeee-------------------------------------
Confidence 9988887899999999999999999999999998866666655
Q ss_pred hcccCCccccceeecccccCCCccccCceeeecchHHHHHHHHhCCCCCCCeEEEecCcCCHHHHHHHHccCCeEEEEeC
Q psy11730 241 LLRTPLFEYETFVNISHTDLKPNVYEGGYKIWECTFDLLNFIKDNVAVDKLSVLDVGCGAGLLGLYTLMNGAAHVSFQDY 320 (496)
Q Consensus 241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~VLDlGcGtG~~~~~la~~~~~~v~giD~ 320 (496)
T Consensus 205 -------------------------------------------------------------------------------- 204 (336)
T 3k2o_A 205 -------------------------------------------------------------------------------- 204 (336)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred CHHHHHHhcCcccccccCCCCceEEEecccCCccccCCCceeEEEEccccccccchHhHhheeeecCCCCCcccEEEeec
Q psy11730 321 NQEVIESLTLPNILMNTDNLEKCKFYHGDWGSLSAVIHSKFDIILTSETIYSVANYNKLLTVWCLFPTHTPKDLLKVTSA 400 (496)
Q Consensus 321 s~~~i~~a~~~~~~~~~~~~~~v~~~~~d~~~~~~~~~~~fD~Ii~~~~l~~~~~~~~~~~~~~l~p~~~~~~~~~~~~~ 400 (496)
|.|.|+|+.....+......
T Consensus 205 ------------------------------------------------------------K~~~L~pP~~~~~ly~~~~~ 224 (336)
T 3k2o_A 205 ------------------------------------------------------------KRWCLFPTSTPRELIKVTRD 224 (336)
T ss_dssp ------------------------------------------------------------EEEEEECTTSCHHHHCCCHH
T ss_pred ------------------------------------------------------------EEEEEeCCCcchhcccCccc
Confidence 33334444322111111111
Q ss_pred cCCcccccccchhhHhcCCCCCCCCCCCCCchhhhccCCceeeeCCcceEEEEeeeeeEEEeecccCCCChhhHHHHhhc
Q psy11730 401 EGGKQRDEAITWFSIIYPRTQLPSWPTEWKPLELVQGPGETVFVPGGWWHVVLNLDTTVAVTQNFCSHTNFPVVYHKTIR 480 (496)
Q Consensus 401 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~e~~~~~Ge~l~iP~gWwh~v~~l~~~i~v~~~~~~~~~~~~~~~~~~~ 480 (496)
.++......++|+...|+......||...++++++++|||+||||.||||+|.++++||+|++||++..|++.+|++|++
T Consensus 225 ~~~~~~~~~~~w~~~~~P~~~~~~~p~~~~~~~~~l~pGd~l~iP~gw~H~v~~~~~sisv~~~f~~~~nl~~~~~~~~~ 304 (336)
T 3k2o_A 225 EGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTIAITQNFASSTNFPVVWHKTVR 304 (336)
T ss_dssp HHGGGTTCHHHHHHHTGGGGGSTTSCGGGCCEEEEECTTCEEEECTTCEEEEEESSCEEEEEEEECCTTTHHHHHHHHHH
T ss_pred ccCCCccchhhhhhhhCcchhhhcccccCceEEEEECCCCEEEeCCCCcEEEecCCCeEEEEcccCCcccHHHHHHHHHh
Confidence 11111234567888888877777788788999999999999999999999999999999999999999999999999999
Q ss_pred CCchhhHHHHHHHhc
Q psy11730 481 GRPKLSKKWYRKLKT 495 (496)
Q Consensus 481 ~~~~~~~~~~~~~~~ 495 (496)
|||||+++|+++|++
T Consensus 305 ~~p~~~~~~~~~~~~ 319 (336)
T 3k2o_A 305 GRPKLSRKWYRILKQ 319 (336)
T ss_dssp HCHHHHHHHHHHHHH
T ss_pred hChHHHHHHHHHHHH
Confidence 999999999999986
|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A | Back alignment and structure |
|---|
| >4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* | Back alignment and structure |
|---|
| >3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* | Back alignment and structure |
|---|
| >3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* | Back alignment and structure |
|---|
| >3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >2ypd_A Probable JMJC domain-containing histone demethyla PROT EIN 2C; oxidoreductase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* | Back alignment and structure |
|---|
| >2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >2xxz_A Lysine-specific demethylase 6B; oxidoreductase, histone demethylation, oxygenase, chromatin modification; HET: 8XQ; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* | Back alignment and structure |
|---|
| >3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} | Back alignment and structure |
|---|
| >3avr_A Lysine-specific demethylase 6A; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} PDB: 3avs_A* | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* | Back alignment and structure |
|---|
| >3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* | Back alignment and structure |
|---|
| >3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} | Back alignment and structure |
|---|
| >2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 | Back alignment and structure |
|---|
| >3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* | Back alignment and structure |
|---|
| >1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* | Back alignment and structure |
|---|
| >3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* | Back alignment and structure |
|---|
| >3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* | Back alignment and structure |
|---|
| >1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} | Back alignment and structure |
|---|
| >4ask_A Lysine-specific demethylase 6B; oxidoreductase, KDM6B, GSK-J1, inhibitor, lysine specific HI demethylase; HET: K0I; 1.86A {Homo sapiens} PDB: 2xue_A* 4eyu_A* 4ez4_A* 4ezh_A* | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A | Back alignment and structure |
|---|
| >2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} | Back alignment and structure |
|---|
| >2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 | Back alignment and structure |
|---|
| >3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} | Back alignment and structure |
|---|
| >1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 496 | ||||
| d1h2ka_ | 335 | b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibit | 4e-13 | |
| d1h2ka_ | 335 | b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibit | 3e-05 | |
| d1vrba1 | 319 | b.82.2.11 (A:8-326) Putative asparaginyl hydroxyla | 4e-08 | |
| d1vrba1 | 319 | b.82.2.11 (A:8-326) Putative asparaginyl hydroxyla | 3e-07 | |
| d1oria_ | 316 | c.66.1.6 (A:) Protein arginine N-methyltransferase | 6e-04 | |
| d2fyta1 | 311 | c.66.1.6 (A:238-548) Protein arginine N-methyltran | 8e-04 |
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: Clavaminate synthase-like family: Hypoxia-inducible factor HIF ihhibitor (FIH1) domain: Hypoxia-inducible factor HIF ihhibitor (FIH1) species: Human (Homo sapiens) [TaxId: 9606]
Score = 68.1 bits (165), Expect = 4e-13
Identities = 21/171 (12%), Positives = 45/171 (26%), Gaps = 35/171 (20%)
Query: 47 KFKIVKENVERIHVKDYSPQEFIEKYEKPNKPVVIKGVTENWNATYKWTLEKLGKKYRNQ 106
+ + R+ D E+ + +PVV+ + A KW LE L + N
Sbjct: 20 SYSFPTRPIPRLSQSD----PRAEELIENEEPVVLTDTNLVYPA-LKWDLEYLQENIGNG 74
Query: 107 KFKCGEDNHGYSKLGKKYRNQKFKCGEDNHGYSH-------------------------- 140
F + + + F+ +
Sbjct: 75 DFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQ 134
Query: 141 ----PRRKKLLDDYEVPIYFQDDLFQYAGEDKRPPYRWFVMGPARSGTGIH 187
+K++ D+ + + Q + ++G + T H
Sbjct: 135 TLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAH 185
|
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Length = 319 | Back information, alignment and structure |
|---|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Length = 319 | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 496 | |||
| d1h2ka_ | 335 | Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum | 99.93 | |
| d1vrba1 | 319 | Putative asparaginyl hydroxylase YxbC {Bacillus su | 99.8 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 99.56 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 99.54 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 99.5 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 99.5 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 99.43 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 99.42 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 99.42 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 99.39 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 99.39 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 99.39 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 99.38 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 99.37 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 99.37 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 99.34 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 99.33 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 99.33 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 99.33 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 99.31 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 99.31 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 99.3 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 99.29 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 99.27 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 99.26 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 99.26 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 99.22 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 99.2 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 99.2 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 99.19 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 99.18 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 99.16 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 99.14 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 99.13 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 99.13 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 99.11 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 99.08 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 99.01 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 99.0 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 98.99 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 98.93 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 98.92 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 98.92 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 98.89 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 98.87 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 98.87 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 98.84 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 98.84 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 98.83 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 98.82 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 98.81 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 98.79 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 98.76 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 98.76 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 98.75 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 98.71 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 98.69 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 98.67 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 98.65 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 98.62 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 98.62 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 98.6 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 98.59 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 98.59 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 98.54 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 98.5 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 98.48 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 98.47 | |
| d1yuba_ | 245 | rRNA adenine dimethylase {Streptococcus pneumoniae | 98.45 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 98.42 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 98.29 | |
| d1jsxa_ | 207 | Glucose-inhibited division protein B (GidB) {Esche | 98.07 | |
| d1zq9a1 | 278 | Probable dimethyladenosine transferase {Human (Hom | 98.06 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 98.05 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 97.95 | |
| d1qyra_ | 252 | High level kasugamycin resistance protein KsgA {Es | 97.94 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 97.84 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 97.77 | |
| d1af7a2 | 193 | Chemotaxis receptor methyltransferase CheR, C-term | 97.77 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 97.74 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 97.73 | |
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 97.68 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 97.65 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 97.43 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 97.42 | |
| d1xdza_ | 239 | Glucose-inhibited division protein B (GidB) {Bacil | 97.36 | |
| d2oyra1 | 250 | Hypothetical protein YhiQ {Shigella flexneri [TaxI | 97.2 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 97.17 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 97.13 | |
| d1ej0a_ | 180 | RNA methyltransferase FtsJ {Escherichia coli [TaxI | 97.11 | |
| d1wg8a2 | 182 | TM0872, methyltransferase domain {Thermus thermoph | 96.93 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 96.91 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 96.85 | |
| d2okca1 | 425 | Type I restriction enzyme StySJI M protein {Bacter | 96.77 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 96.76 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 96.76 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 96.33 | |
| d1i4wa_ | 322 | Transcription factor sc-mtTFB {Baker's yeast (Sacc | 96.3 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 96.08 | |
| d1dcta_ | 324 | DNA methylase HaeIII {Haemophilus aegyptius [TaxId | 95.84 | |
| d2ar0a1 | 524 | M.EcoKI {Escherichia coli [TaxId: 562]} | 95.55 | |
| d2c7pa1 | 327 | DNA methylase HhaI {Haemophilus haemolyticus [TaxI | 95.5 | |
| d1booa_ | 320 | m.PvuII N4 cytosine-specific DNA methyltransferase | 95.43 | |
| d2bm8a1 | 232 | Cephalosporin hydroxylase CmcI {Streptomyces clavu | 95.28 | |
| d2p41a1 | 257 | An RNA cap (nucleoside-2'-O-)-methyltransferase do | 95.28 | |
| d1ixka_ | 313 | Hypothetical methyltransferase PH1374 {Archaeon Py | 94.98 | |
| d1sqga2 | 284 | Ribosomal RNA small subunit methyltransferase B, R | 94.97 | |
| d1g60a_ | 256 | Methyltransferase mboII {Moraxella bovis [TaxId: 4 | 94.93 | |
| d1eg2a_ | 279 | m.RsrI N6 adenosine-specific DNA methyltransferase | 94.15 | |
| d1g55a_ | 343 | DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | 93.36 | |
| d1o9ga_ | 249 | rRNA methyltransferase AviRa {Streptomyces viridoc | 90.93 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 90.2 | |
| d1x82a_ | 190 | Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc | 86.8 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 85.98 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 82.47 | |
| d1zkda1 | 365 | Hypothetical protein RPA4359 {Rhodopseudomonas pal | 81.33 |
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: Clavaminate synthase-like family: Hypoxia-inducible factor HIF ihhibitor (FIH1) domain: Hypoxia-inducible factor HIF ihhibitor (FIH1) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93 E-value=6e-28 Score=242.00 Aligned_cols=141 Identities=16% Similarity=0.105 Sum_probs=100.1
Q ss_pred cCCCceeeecCCCCCHHHHHHHhcCCCCcEEEecCCCCCcCCCCCCHHHHHhhcCCeeEEeeecCCC-------------
Q psy11730 50 IVKENVERIHVKDYSPQEFIEKYEKPNKPVVIKGVTENWNATYKWTLEKLGKKYRNQKFKCGEDNHG------------- 116 (496)
Q Consensus 50 ~~~~~I~Ri~~~~ls~eeF~~~y~~~~~PvVi~g~~~~WpA~~~Wt~~~L~~~~g~~~v~v~~~~~~------------- 116 (496)
....+|+|++..++ |.++|+++++||||+|++.+|||+ +||++||+++||+..|+|.....+
T Consensus 23 ~~~~~vpr~~~~~~----~~e~y~~~~~PvVi~g~~~~Wpa~-kWt~dyL~~~~Gd~~V~v~~~~~~~~~~~~~~~~~~~ 97 (335)
T d1h2ka_ 23 FPTRPIPRLSQSDP----RAEELIENEEPVVLTDTNLVYPAL-KWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANF 97 (335)
T ss_dssp SCEEECCEECTTCH----HHHHHHHTTCCEEESCCCTTGGGG-GCCHHHHHHHSCSCCEEEEEESSSBCCCCCGGGGGGG
T ss_pred CCCcccCccCCCCc----CHHHHhcCCCCEEEeCCCCCCCcc-cCCHHHHHHhhCCceEEEEEecCcccccccccccccc
Confidence 35568999865433 567888899999999999999998 699999999999999999743321
Q ss_pred --------ccccCHHHHHHHhhcCC---CC-CCCCcc-----ccccccccCCCCCCCchhhhcccCCCCCCCccceEecC
Q psy11730 117 --------YSKLGKKYRNQKFKCGE---DN-HGYSHP-----RRKKLLDDYEVPIYFQDDLFQYAGEDKRPPYRWFVMGP 179 (496)
Q Consensus 117 --------~~~m~~~~f~~~~~~~~---~~-p~y~~~-----~~~~L~~d~~~P~~f~~d~~~~~~~~~~p~~~w~~iG~ 179 (496)
+..|+|++|++++.+.. .+ ++|+.. ..+.+..|+..|.++..+.........+....++|||+
T Consensus 98 ~~~~~~~~~~~~~~~ef~~~~~~~~~~~~~~~~yl~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~lwiG~ 177 (335)
T d1h2ka_ 98 QNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGM 177 (335)
T ss_dssp TTCCCSEEEEEECHHHHHHHHHHHHHTTCCCEEEEEEECCTTSCHHHHHHHHTSCHHHHHHHHHHHTCCCEEECEEEEEC
T ss_pred cccccccchhcccHHHHHHHHHhccccCCCcceEhhhccccccChhhhcccccCcccccchhhccccccCCcceEEEEcC
Confidence 11799999999886432 22 344432 23556667766654322211112222355667899999
Q ss_pred CCCccccccCCCCCCC
Q psy11730 180 ARSGTGIHIDPLGTNP 195 (496)
Q Consensus 180 ~gs~T~lH~D~~~~~~ 195 (496)
+||+|++|+|++++..
T Consensus 178 ~gs~t~~H~D~~~~~~ 193 (335)
T d1h2ka_ 178 EGNVTPAHYDEQQNFF 193 (335)
T ss_dssp TTCEEEEECCSEEEEE
T ss_pred CCCCCccccccccceE
Confidence 9999999999986555
|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} | Back information, alignment and structure |
|---|
| >d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} | Back information, alignment and structure |
|---|
| >d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} | Back information, alignment and structure |
|---|
| >d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} | Back information, alignment and structure |
|---|
| >d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|