Diaphorina citri psyllid: psy1173


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50
MTHLLKKVLRKQAENPSQKVFVTSEAVPTLKCKTGGGVVLTCGQGDTGQLGLGPDVMERKTFALVEDLDNVVEVVVGGMHTVCLTEDGKVYTWGCNDEGALGREAEGDSEFIPQTVNLPKKAVQISAGDSHSVALLEDGTVYAWGSFRDSHGSMGLKGEGIQKTPLKLESVSGIVKIASGADHFVMLTSRGNLLTAGCPEQGQLGRITQRSASRNARRGMSFLEPGEVPLKRKHIDDVFTGVYNTFISSKGSILAFGLNNYSQLGEADSEVQKSGNTCFFTPHLIKSLSDKKFTMLASGQHHSLALNSEGKIYAFGRHDYGRLGLKNVSEPVTEPTPIPSLQDKTITSIACGNCVSFAIDSEGVLYGWGMGNGYQLGNGKEDDILNSEGKIYAFGRHDYGRLGLKNVSEPVTEPTPIPSLQDKTITSIACGNCVSFAIDSEGVLYGWGMGNGYQLGNGKEDDILEPMKIEGKQLNNYTVLQVASGGQHSVILAKPKPN
ccccccEEEEEccccccccEEEEEccccEEEEECccccEEEEEcccccccccccccccEEcEEEcccccccEEEEEcccEEEEEEccccEEEEEcccccccccccccccEEccEECccccccEEEEcccccEEEEcccccEEEEcccccccccccccccccCEEEEECccccccEEEEcccccEEEEEccccEEEEEccccccccccccccccccccccccccccCEEccccccEEEEEEcccEEEEEEcccEEEEEcccccccccccccccccccccccccEEEcccccccEEEEEcccccEEEEEccccEEEEEcccccccccccccccccccEECcccccccEEEEEccccEEEEEEccccEEEECcccccccccccccccccccccEEEEEcccccccccccccccccccEECcccccccEEEEEccccEEEEEEccccEEEEEccccccccccccccEEccEEECcccccccEEEEEEEccccEEEEEccccc
*****KK************VFVTSEAVPTLKCKTGGGVVLTCGQGDTGQLGLGPDVMERKTFALVEDLDNVVEVVVGGMHTVCLTEDGKVYTWGCNDEGALGREAEGDSEFIPQTVNLPKKAVQISAGDSHSVALLEDGTVYAWGSFRDSHGSMGLKGEGIQKTPLKLESVSGIVKIASGADHFVMLTSRGNLLTAGCPEQGQLGRITQRSASRNA*R**SFLEPGEVPLKRKHIDDVFTGVYNTFISSKGSILAFGLNNYSQLGEADSEVQKSGNTCFFTPHLIKSLSDKKFTMLASGQHHSLALNSEGKIYAFGRHDYGRLGLKNVSEPVTEPTPIPSLQDKTITSIACGNCVSFAIDSEGVLYGWGMGNGYQLGNGKEDDILNSEGKIYAFGRHDYGRLGLKNVSEPVTEPTPIPSLQDKTITSIACGNCVSFAIDSEGVLYGWGMGNGYQLGNGKEDDILEPMKIEGKQLNNYTVLQVASGGQHSVILAKPK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTHLLKKVLRKQAENPSQKVFVTSEAVPTLKCKTGGGVVLTCGQGDTGQLGLGPDVMERKTFALVEDLDNVVEVVVGGMHTVCLTEDGKVYTWGCNDEGALGREAEGDSEFIPQTVNLPKKAVQISAGDSHSVALLEDGTVYAWGSFRDSHGSMGLKGEGIQKTPLKLESVSGIVKIASGADHFVMLTSRGNLLTAGCPEQGQLGRITQRSASRNARRGMSFLEPGEVPLKRKHIDDVFTGVYNTFISSKGSILAFGLNNYSQLGEADSEVQKSGNTCFFTPHLIKSLSDKKFTMLASGQHHSLALNSEGKIYAFGRHDYGRLGLKNVSEPVTEPTPIPSLQDKTITSIACGNCVSFAIDSEGVLYGWGMGNGYQLGNGKEDDILNSEGKIYAFGRHDYGRLGLKNVSEPVTEPTPIPSLQDKTITSIACGNCVSFAIDSEGVLYGWGMGNGYQLGNGKEDDILEPMKIEGKQLNNYTVLQVASGGQHSVILAKPKPN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Regulator of chromosome condensation Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP. Involved in the regulation of onset of chromosome condensation in the S phase. Binds both to the nucleosomes and double-stranded DNA. RCC1-Ran complex (together with other proteins) acts as a component of a signal transmission pathway that detects unreplicated DNA. Plays a key role in nucleo-cytoplasmic transport, mitosis and nuclear-envelope assembly.confidentP18754
Regulator of chromosome condensation Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP. Involved in the regulation of onset of chromosome condensation in the S phase. Binds both to the nucleosomes and double-stranded DNA. RCC1-Ran complex (together with other proteins) acts as a component of a signal transmission pathway that detects unreplicated DNA. Plays a key role in nucleo-cytoplasmic transport, mitosis and nuclear-envelope assembly.confidentQ8VE37
Protein pim1 Promotes the exchange of Ran(spi1)-bound GDP by GTP. Involved in the control of mitosis. Regulates a variety of nuclear events, including mitotic check-point, chromosome decondensation and mRNA processing/transport.confidentP28745

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0007088 [BP]regulation of mitosisprobableGO:0007346, GO:0051726, GO:0033043, GO:0010564, GO:0050794, GO:0051783, GO:0065007, GO:0008150, GO:0051128, GO:0050789
GO:0007052 [BP]mitotic spindle organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0022402, GO:0044699, GO:0000226, GO:0007049
GO:0007059 [BP]chromosome segregationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0031492 [MF]nucleosomal DNA bindingprobableGO:0043566, GO:0097159, GO:0031491, GO:0031490, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:0003682, GO:1901363
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0000082 [BP]G1/S transition of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0000794 [CC]condensed nuclear chromosomeprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0051225 [BP]spindle assemblyprobableGO:0006996, GO:0022607, GO:0007010, GO:0071822, GO:0070271, GO:0043933, GO:0071840, GO:0006461, GO:0044763, GO:0016043, GO:0065003, GO:0007051, GO:0044085, GO:0000226, GO:0044699, GO:0008150, GO:0022402, GO:0009987, GO:0070925, GO:0007049, GO:0007017
GO:0042393 [MF]histone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0007090 [BP]regulation of S phase of mitotic cell cycleprobable
GO:0005087 [MF]Ran guanyl-nucleotide exchange factor activityprobableGO:0005088, GO:0005083, GO:0005085, GO:0030695, GO:0003674, GO:0060589, GO:0030234
GO:0007417 [BP]central nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OF7, chain A
Confidence level:very confident
Coverage over the Query: 17-213,276-495
View the alignment between query and template
View the model in PyMOL
Template: 3QHY, chain B
Confidence level:very confident
Coverage over the Query: 16-157,168-207,226-269,287-326,344-361
View the alignment between query and template
View the model in PyMOL
Template: 1I2M, chain B
Confidence level:very confident
Coverage over the Query: 54-383
View the alignment between query and template
View the model in PyMOL