Diaphorina citri psyllid: psy11781

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------123
MNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDISNAGPARPSTDQTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDIKNNNQPPNTKSNAGPARPSTDQTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDI
cccccccccccccccccccccccccccEEEEEEEECcccCEEEEEccccccccccccccccEEEEEEcccccEEEEEEcccccccccccEEEEEEEEEcccccEEEEEccccccEEEEEEccccCEEEEccccccccccccCEEEccEEEEECccEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEEccHHcccccccccccccccEEEEcccccccccccEEEcccccEEEEcccccEEEEECccccccccccCEEEEEccccEEcccccEEccccEEEEEcccccHHHccccccccccEEEEEECHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEcccHHHHHHHHccccccccccccccCEECcccEEEEEcccccccccEEEEEEcccccccccccccccccccccccccccEEEEEEEECccccEEEEcccccccccccccccccEEEEEEcccccEEEEEEcccccccccccEEEEEEEEEcccccEEEEEccccccEEEEEEccccCEEEEccccccccccccCEEEccEEEEEcccEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEcHHHcccccccccccccccEEEEccccccccccEEEEcccccEEEEcccccEEEEECccccccccccCEEEEEccccEEccccCEEccccEEEEEccccHHHHccccccccccEEEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEEEEEcEEEcccHHHHHHHHccccccccccccccCEECcccEEEEEcccccccccEEEEEEcccccccccccccccccccccccccccEEEEEEEECccccEEEEcccccccccccccccccEEEEEEcccccEEEEEEcccccccccccEEEEEEEEEccccccEEEEccccccEEEEEEccccCEEEEccccccccccccCEEEccEEEEEcccEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEEcHHHcccccccccccccccEEEEcccccccccccEEEcccccEEEEcccccEEEEECccccccccccCEEEEEccccEEccccCEEccccEEEEEccccHHHHccccccccccEEEEEEEcccc
*****ES*ILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDISNAGPARPSTDQTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDIKN*******************QTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDISNAGPARPSTDQTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDIKNNNQPPNTKSNAGPARPSTDQTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008150 [BP]biological_processprobable
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3Q6K, chain A
Confidence level:very confident
Coverage over the Query: 376-607,636-786
View the alignment between query and template
View the model in PyMOL
Template: 3Q6K, chain A
Confidence level:very confident
Coverage over the Query: 826-1057,1086-1227
View the alignment between query and template
View the model in PyMOL
Template: 2QE8, chain A
Confidence level:very confident
Coverage over the Query: 859-1051,1075-1226
View the alignment between query and template
View the model in PyMOL
Template: 4A0P, chain A
Confidence level:confident
Coverage over the Query: 466-488,501-572,586-603,636-662,673-776,795-840,851-939,952-1022,1036-1048,1081-1112,1123-1205
View the alignment between query and template
View the model in PyMOL
Template: 3C75, chain H
Confidence level:probable
Coverage over the Query: 417-455,466-753
View the alignment between query and template
View the model in PyMOL
Template: 4A2L, chain A
Confidence level:probable
Coverage over the Query: 233-338,350-454,467-488,502-572
View the alignment between query and template
View the model in PyMOL
Template: 3Q7M, chain A
Confidence level:probable
Coverage over the Query: 62-131
View the alignment between query and template
View the model in PyMOL
Template: 3O4H, chain A
Confidence level:probable
Coverage over the Query: 10-129
View the alignment between query and template
View the model in PyMOL