Psyllid ID: psy11781

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------123
MNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDISNAGPARPSTDQTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDIKNNNQPPNTKSNAGPARPSTDQTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDI
cccccccccccccccccccccccccccEEEEEEEEEcccEEEEEEccccccccccccccccEEEEEEcccccEEEEEEcccccccccccEEEEEEEEEcccccEEEEEccccccEEEEEEccccEEEEEccccccccccccEEEEccEEEEEEccEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEEccHHcccccccccccccccEEEEcccccccccccEEEcccccEEEEcccccEEEEEEccccccccccEEEEEEccccEEcccccEEccccEEEEEcccccHHHccccccccccEEEEEEEHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEcccHHHHHHHHccccccccccccccEEEEcccEEEEEcccccccccEEEEEEcccccccccccccccccccccccccccEEEEEEEEEccccEEEEcccccccccccccccccEEEEEEcccccEEEEEEcccccccccccEEEEEEEEEcccccEEEEEccccccEEEEEEccccEEEEEccccccccccccEEEEccEEEEEcccEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEcHHHcccccccccccccccEEEEccccccccccEEEEcccccEEEEcccccEEEEEEccccccccccEEEEEEccccEEccccEEEccccEEEEEccccHHHHccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcEEEcccHHHHHHHHccccccccccccccEEEEcccEEEEEcccccccccEEEEEEcccccccccccccccccccccccccccEEEEEEEEEccccEEEEcccccccccccccccccEEEEEEcccccEEEEEEcccccccccccEEEEEEEEEccccccEEEEccccccEEEEEEccccEEEEEccccccccccccEEEEccEEEEEcccEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEEcHHHcccccccccccccccEEEEcccccccccccEEEcccccEEEEcccccEEEEEEccccccccccEEEEEEccccEEccccEEEccccEEEEEccccHHHHccccccccccEEEEEEEcccc
cccccccccccccccccHccccccccEEEEEEEEEcccccEEEEEccEEccccccccccccEEEEEEcccccEEEEEEccHHHcccccEEEEEEEEcccccccEEEEEEcccccEEEEEEcccccEEEEEccccccccccccEEEccEEEEEcccEEEEEEcccccccEEEcccEEEcccccccccccHHHccccccEEEEEEccccccEEEEcHHHHcccccccccccccccEEEEccccccccccEEEEccccEEEEEEccccEEEEEccccccccHcccEEEEEcccEEEEccccEEccccEEEEEEcccHHHHHccccccccEEEEEEccHHHHHccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccHHHHHHHHHccccccccccccccEEcccEEEEEEcccccccccEEEEEEcccccccccccccccccHccccccccEEEEEEEEEcccccEEEEEccEEEcccccccccccEEEEEEcccccEEEEEEccHHHcccccEEEEEEEEcccccccEEEEEEcccccEEEEEEcccccEEEEEccccccccccccEEEccEEEEEcccEEEEEEccccccccEEcccEEEcccccccccccHHHccccccEEEEEEccccccEEEEcHHHHcccccccccccccccEEEEccccccccccEEEEccccEEEEEEccccEEEEEccccccccHcccEEEEEcccEEEEccccEEccccEEEEEEcccHHHHcccccccccEEEEEEccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEcccccHHHHHHHHHccccccccccccccEEcccEEEEEEcccccccccEEEEEEccccccccccccccccHHccccccccEEEEEEEEEcccccEEEEEccEEEccccccEccccEEEEEEcccccEEEEEEccHHHcccccEEEEEEEEcccccccEEEEEEcccccEEEEEEcccccEEEEEccccccccccccEEEccEEEEEcccEEEEEEcccccccEEEEccEccccccccccccccccccccccEEEEEEccccccEEEEcHHHHcccccccccccccccEEEEccccccccccEEEEccccEEEEEEccccEEEEEccccccccHcccEEEEEcccEEEEccccEEccccEEEEEEcccHHHHcccccccccEEEEEEEcHccc
mndpsespillpypnwsyfddsncnsLISVFRMSvdkcdrlwiMDTGVTNILSSIQqlcppkimvfdlKTNTLIRKYIlptaqvfegslfSNIVTEVVEDCDHVFAYVNDVFRYGLIVYdffkntsyrlthpymypeptqstyildnlkfrwvdgifgmaispelsgkykrhpyeyyhynvhhyngtnvdktirddqrymyFHSLSSNRHYYVSTtdlrnssryvnssdiDEYFHYLgsrfrntqasasainsnGVMFYNLVTKhsvgcwntktkvylpqtqdiVQTSRDIlnfpndlkidpndniwILSNKLHQYLYGFLDFNVYNYRILVAnsndisnagparpstdqtksfhpsvpsiypsvpsnaypssshfQVVFRWKIMDFVFRDNkqkanlirsnkfipennlplgigiwrstiflsfpkwkagipftlasfnmndpsespillpypnwsyfddsncnsLISVFRMSvdkcdrlwiMDTGVTNILSSIQqlcppkimvfdlKTNTLIRKYIlptaqvfegslfSNIVTEVVEDCDHVFAYVNDVFRYGLIVYdffkntsyrlthpymypeptqstyildnlkfrwvdgifgmaispelsgkykrhpyeyyhynvhhyngtnvdktirddqrymyFHSLSSNRHYYVSTtdlrnssryvnssdiDEYFHYLgsrfrntqasasainsnGVMFYNLVTKhsvgcwntktkvylpqtqdiVQTSRDIlnfpndlkidpndniwILSNKLHQYLYGFLDFNVYNYRILVAnsndiknnnqppntksnagparpstdqtksfhpsvpsiypsvpsnaypssshfQVVFRWKIMDFVFRDNkqkanlirsnkfipennlplgigiwrstiflsfpkwkagipftlasfnmndpsespillpypnwsyfddsncnsLISVFRMSvdkcdrlwiMDTGVTNILSSIQqlcppkimvfdlKTNTLIRKYIlptaqvfegslfSNIVTEVVEDCDHVFAYVNDVFRYGLIVYdffkntsyrlthpymypeptqstyildnlkfrwvdgifgmaispelsgkykrhpyeyyhynvhhyngtnvdktirddqrymyFHSLSSNRHYYVSTtdlrnssryvnssdiDEYFHYLgsrfrntqasasainsnGVMFYNLVTKhsvgcwntktkvylpqtqdiVQTSRDIlnfpndlkidpndniwILSNKLHQYLYGFLDFNVYNYRILVANSNDI
MNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDISNAGPARPSTDQTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKAnlirsnkfipennlpLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSndiknnnqppntksnagpaRPSTDQTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKAnlirsnkfipennlpLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDI
MNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRhpyeyyhynvhhyNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDISNAGPARPSTDQTKSFHpsvpsiypsvpsNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRhpyeyyhynvhhyNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDIKNNNQPPNTKSNAGPARPSTDQTKSFHpsvpsiypsvpsNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRhpyeyyhynvhhyNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDI
********ILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVAN***************************************SHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVAN**************************************************HFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVA*****
*****ES***LPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDISNAGPARPSTDQTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPS*SP*LLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDIKN*******************QTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESP*LLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDI
MNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDISNA**************PSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDIKNNNQP*********************PSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDI
*****ESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDISNAGPARPSTDQTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDIKNNNQPPNTKSNAGPARPSTDQTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSN*I
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDISNAGPARPSTDQTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDIKNNNQPPNTKSNAGPARPSTDQTKSFHPSVPSIYPSVPSNAYPSSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1228 2.2.26 [Sep-21-2011]
Q9GP71568 Protein yellow OS=Drosoph N/A N/A 0.340 0.735 0.336 8e-68
Q9BI18560 Protein yellow OS=Drosoph no N/A 0.333 0.732 0.336 1e-67
O02437568 Protein yellow OS=Drosoph N/A N/A 0.321 0.695 0.339 9e-67
Q9GP81568 Protein yellow OS=Drosoph N/A N/A 0.321 0.695 0.341 1e-66
Q9BI23541 Protein yellow OS=Drosoph N/A N/A 0.326 0.741 0.328 2e-66
Q9BI17541 Protein yellow OS=Drosoph N/A N/A 0.326 0.741 0.328 3e-66
P09957541 Protein yellow OS=Drosoph no N/A 0.326 0.741 0.332 6e-66
P62407541 Protein yellow OS=Drosoph N/A N/A 0.326 0.741 0.332 1e-65
P62408541 Protein yellow OS=Drosoph N/A N/A 0.326 0.741 0.332 1e-65
O18330432 Major royal jelly protein no N/A 0.305 0.868 0.266 1e-40
>sp|Q9GP71|YELL_DROMD Protein yellow OS=Drosophila madeirensis GN=y PE=3 SV=1 Back     alignment and function desciption
 Score =  259 bits (663), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 161/478 (33%), Positives = 253/478 (52%), Gaps = 60/478 (12%)

Query: 371 PSSSHFQVVFR--WKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKW 428
           PS + +++  R  W  +DF F + + K   + S  +IP N LP+G+  + + +F++ P+W
Sbjct: 25  PSQAAYKLQERYSWNQLDFAFPNARLKEQALASGDYIPTNALPVGVEHFGNRLFVTVPRW 84

Query: 429 KAGIPFTLASFNMNDP-SESPILLPYPNWSYFDDSNC-NSLISVFRMSVDKCDRLWIMDT 486
           + GIP TL   NM+   + SP L+PYP+W      +C NS+ + +R+ VD+C RLW++DT
Sbjct: 85  RDGIPATLTYINMDHSVTGSPELIPYPDWRANTAGDCANSITTAYRIKVDECGRLWVLDT 144

Query: 487 GVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFA 546
           G   I ++    CP  I +FDL TNT IR+Y LP A     +  +NI  ++ ++CD  FA
Sbjct: 145 GTVGIGNTTTNPCPYAINIFDLTTNTRIRRYELPAADTNPNTFIANIAVDIGKNCDDAFA 204

Query: 547 YVNDVFRYGLIVYDFFKNTSYRLT-HPYMYPEPTQSTYILDNLKFRW-VDGIFGMAISPE 604
           Y  D   YGLI Y +  N S+R + H Y +P+P +  + +  + F+W  +GIFGM+++P 
Sbjct: 205 YFADELGYGLISYSWELNKSWRFSAHSYFFPDPLRGDFNVAGINFQWGEEGIFGMSLTPI 264

Query: 605 LSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRY 664
            S  Y                            R +YF  L+S+R + VST  LR+ +R 
Sbjct: 265 RSDGY----------------------------RTLYFSPLASHRQFAVSTRILRDETR- 295

Query: 665 VNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDI 724
             + D    F  L  R  N   ++  ++ +GV  +NL+ +++VGCW++    Y PQ+  I
Sbjct: 296 --TEDSYHDFVALDERGPNAHTTSRVMSDDGVELFNLIDQNAVGCWHSSMP-YSPQSHGI 352

Query: 725 VQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVYNYRI-------LVANS-N 776
           V      L FP D+KID N N+W+LS+++  +L   LD++  N+RI       L+ N+  
Sbjct: 353 VDRDDVGLVFPADVKIDENKNVWVLSDRMPVFLLSDLDYSDTNFRIYTAPLATLIENTVC 412

Query: 777 DIKNNN-QPPNTKSNAGPARP-----------STDQTKSFHPSVP--SIYPSVPSNAY 820
           D++NN   PPNT S    A P           +T+Q +S     P  S  PS+PS  Y
Sbjct: 413 DLRNNAYGPPNTVSIPKQAAPGHSAVGPPLYTTTNQYRSLLSQKPQTSWGPSLPSRNY 470
Controls the pigmentation pattern of the adult cuticle and larval mouth parts.
Drosophila madeirensis (taxid: 30013)
>sp|Q9BI18|YELL_DROPS Protein yellow OS=Drosophila pseudoobscura pseudoobscura GN=y PE=3 SV=2 Back     alignment and function description
>sp|O02437|YELL_DROSU Protein yellow OS=Drosophila subobscura GN=y PE=3 SV=1 Back     alignment and function description
>sp|Q9GP81|YELL_DROGU Protein yellow OS=Drosophila guanche GN=y PE=3 SV=1 Back     alignment and function description
>sp|Q9BI23|YELL_DROER Protein yellow OS=Drosophila erecta GN=y PE=3 SV=1 Back     alignment and function description
>sp|Q9BI17|YELL_DROYA Protein yellow OS=Drosophila yakuba GN=y PE=3 SV=1 Back     alignment and function description
>sp|P09957|YELL_DROME Protein yellow OS=Drosophila melanogaster GN=y PE=1 SV=1 Back     alignment and function description
>sp|P62407|YELL_DROSI Protein yellow OS=Drosophila simulans GN=y PE=3 SV=1 Back     alignment and function description
>sp|P62408|YELL_DROMA Protein yellow OS=Drosophila mauritiana GN=y PE=3 SV=1 Back     alignment and function description
>sp|O18330|MRJP1_APIME Major royal jelly protein 1 OS=Apis mellifera GN=MRJP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1228
328702791469 PREDICTED: protein yellow-like [Acyrthos 0.306 0.801 0.423 8e-94
148277604552 yellow-h precursor [Apis mellifera] gi|8 0.308 0.686 0.436 1e-93
383866095553 PREDICTED: protein yellow-like [Megachil 0.308 0.685 0.436 1e-93
380022677622 PREDICTED: protein yellow-like [Apis flo 0.298 0.590 0.433 1e-92
350424571550 PREDICTED: protein yellow-like [Bombus i 0.308 0.689 0.426 2e-91
340716436551 PREDICTED: protein yellow-like [Bombus t 0.308 0.687 0.424 3e-91
242017765428 major royal jelly protein 4 precursor, p 0.295 0.848 0.434 8e-89
307168907602 Protein yellow [Camponotus floridanus] 0.309 0.631 0.413 1e-88
307201057544 Protein yellow [Harpegnathos saltator] 0.306 0.691 0.409 2e-88
229576867571 yellow-h precursor [Nasonia vitripennis] 0.364 0.782 0.387 3e-88
>gi|328702791|ref|XP_001945925.2| PREDICTED: protein yellow-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  352 bits (903), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 176/416 (42%), Positives = 261/416 (62%), Gaps = 40/416 (9%)

Query: 372 SSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAG 431
            ++ F+  F W  +D  + +   K   I +  FIP NNL LG+ +W++ +FLS P+W+ G
Sbjct: 76  ENTGFKDRFTWGQIDLEYPNQDSKQMAINTGAFIPVNNLLLGLEVWKNKMFLSLPQWRPG 135

Query: 432 IPFTLASFNMNDPSESPILLPYPNWSYFDDS--NCNSLISVFRMSVDKCDRLWIMDTGVT 489
           IP TLA  N+N  ++SPIL PYP+W+++ ++   C+ L+SVFRM VDKCDRLW++DTG  
Sbjct: 136 IPVTLAYVNLNSHAKSPILKPYPSWNWYANNMNRCHGLVSVFRMEVDKCDRLWVLDTGAI 195

Query: 490 NILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVED-CDHVFAYV 548
           N+ + + Q+CP K+ VFDLKT+T I+++I+P  Q  + SLF+NIV E++ D C+  +AY+
Sbjct: 196 NLANKVDQICPVKLDVFDLKTDTHIKRFIIPKNQTLKDSLFTNIVVEILNDNCEDAYAYM 255

Query: 549 NDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGK 608
           +DVF+YGL+VY + ++ S R+ HPY YP+P    Y +D + F W+DGIFGM +SP+    
Sbjct: 256 SDVFQYGLVVYSYKEDVSRRINHPYFYPDPLYCHYSMDGITFNWMDGIFGMCLSPDGGA- 314

Query: 609 YKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSS 668
                                       QR +YFHSLSSN  +YV T  LRN +  +   
Sbjct: 315 ---------------------------GQRVLYFHSLSSNNEFYVPTASLRNGT--LREG 345

Query: 669 DIDEYFHYLG----SRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQDI 724
           DI E+F  L     +R ++ Q+S  A+++ GVM+YNLVT   VGCW+T  + +   TQ +
Sbjct: 346 DIIEHFFALNDSRCARHQSCQSSGMAVDAKGVMYYNLVTAGKVGCWDTG-RPFESVTQGL 404

Query: 725 VQTSRDILNFPNDLKIDPN--DNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDI 778
           + +    L+FPNDLK+D      +W+LSN LH+YLYG  D N  NYRI+VA ++D+
Sbjct: 405 LSSGPTPLSFPNDLKVDKESAQRVWMLSNGLHKYLYGKTDPNQINYRIMVAYTDDV 460

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|148277604|ref|NP_001091687.1| yellow-h precursor [Apis mellifera] gi|82527239|gb|ABB81847.1| yellow-h [Apis mellifera] Back     alignment and taxonomy information
>gi|383866095|ref|XP_003708507.1| PREDICTED: protein yellow-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380022677|ref|XP_003695165.1| PREDICTED: protein yellow-like [Apis florea] Back     alignment and taxonomy information
>gi|350424571|ref|XP_003493840.1| PREDICTED: protein yellow-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340716436|ref|XP_003396704.1| PREDICTED: protein yellow-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|242017765|ref|XP_002429357.1| major royal jelly protein 4 precursor, putative [Pediculus humanus corporis] gi|212514266|gb|EEB16619.1| major royal jelly protein 4 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307168907|gb|EFN61807.1| Protein yellow [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307201057|gb|EFN80989.1| Protein yellow [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|229576867|ref|NP_001153394.1| yellow-h precursor [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1228
FB|FBgn0039896463 yellow-h "yellow-h" [Drosophil 0.187 0.496 0.424 2.3e-82
FB|FBgn0041713438 yellow-c "yellow-c" [Drosophil 0.145 0.408 0.364 9.2e-74
FB|FBgn0032601453 yellow-b "yellow-b" [Drosophil 0.192 0.523 0.312 2e-63
UNIPROTKB|Q8MZM5462 dce "Dopachrome conversion enz 0.190 0.506 0.299 4.1e-51
FB|FBgn0038105452 yellow-f2 "yellow-f2" [Drosoph 0.166 0.451 0.320 1e-42
FB|FBgn0004034541 y "yellow" [Drosophila melanog 0.215 0.489 0.341 1e-42
UNIPROTKB|O18330432 MRJP1 "Major royal jelly prote 0.184 0.523 0.304 2.3e-42
FB|FBgn0041712432 yellow-d "yellow-d" [Drosophil 0.176 0.502 0.298 3.7e-40
FB|FBgn0041710447 yellow-f "yellow-f" [Drosophil 0.179 0.494 0.318 2.1e-39
FB|FBgn0041711530 yellow-e "yellow-e" [Drosophil 0.184 0.426 0.341 3.9e-38
FB|FBgn0039896 yellow-h "yellow-h" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 571 (206.1 bits), Expect = 2.3e-82, Sum P(3) = 2.3e-82
 Identities = 99/233 (42%), Positives = 156/233 (66%)

Query:   822 SSSHFQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGIWRSTIFLSFPKWKAG 881
             S S  ++V+ WK +DF++    Q+   I +  F+P+NNLPLGI +  + +F++ P+WK G
Sbjct:    49 SESQLEIVYEWKYLDFLYSTFVQRQQSILNGDFVPKNNLPLGIDVHNNRLFVTTPRWKNG 108

Query:   882 IPFTLASFNMNDPSESPILLPYPNWSYFDDSN---CNSLISVFRMSVDKCDRLWIMDTGV 938
             +P +L +        SP + PYPNW    + N   C+ L+SV+R +VD+CDR+W++D+G+
Sbjct:   109 VPASLGTLPFPPKESSPAIKPYPNWEAHGNPNNPDCSKLMSVYRTAVDRCDRIWLIDSGI 168

Query:   939 TNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYV 998
              N   ++ Q+CPPKI+V+DLK++ LI +Y L  + V + SL SNIV ++ EDCD   A V
Sbjct:   169 VNATINLNQICPPKIVVYDLKSDELIVRYNLEASHVKQDSLHSNIVVDIGEDCDDAHAIV 228

Query:   999 NDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAI 1051
             +DV+R+GL+VY   KN S+R+T+   YP+P  S + +  L F+W+DG+FGM+I
Sbjct:   229 SDVWRFGLLVYSLSKNRSWRVTNYNFYPDPFASDFNVYGLNFQWLDGVFGMSI 281
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0048067 "cuticle pigmentation" evidence=IBA
GO:0016853 "isomerase activity" evidence=IBA
GO:0042438 "melanin biosynthetic process" evidence=IBA
GO:0005576 "extracellular region" evidence=IBA
FB|FBgn0041713 yellow-c "yellow-c" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032601 yellow-b "yellow-b" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MZM5 dce "Dopachrome conversion enzyme" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
FB|FBgn0038105 yellow-f2 "yellow-f2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004034 y "yellow" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|O18330 MRJP1 "Major royal jelly protein 1" [Apis mellifera (taxid:7460)] Back     alignment and assigned GO terms
FB|FBgn0041712 yellow-d "yellow-d" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0041710 yellow-f "yellow-f" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0041711 yellow-e "yellow-e" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1228
pfam03022285 pfam03022, MRJP, Major royal jelly protein 4e-81
pfam03022285 pfam03022, MRJP, Major royal jelly protein 1e-80
pfam03022285 pfam03022, MRJP, Major royal jelly protein 1e-80
>gnl|CDD|217322 pfam03022, MRJP, Major royal jelly protein Back     alignment and domain information 
 Score =  266 bits (683), Expect = 4e-81
 Identities = 120/315 (38%), Positives = 184/315 (58%), Gaps = 34/315 (10%)

Query: 468 ISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEG 527
           +SV+R++VD+CDRLW++D+G+ N L   +Q+CPPK++VFDL T+ L++++ LP       
Sbjct: 1   VSVYRIAVDECDRLWVLDSGIVNTLQPPKQICPPKLLVFDLATDKLLKRFELPADVAKGN 60

Query: 528 SLFSNIVTEVVED-CDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILD 586
           S   N+V +V +D CD  F Y+ D    GLIVYD   + S+R+ H   YP+P    + + 
Sbjct: 61  SRLVNLVVDVGDDTCDDTFVYIADAKGRGLIVYDLADDKSWRVEHNTFYPDPDFGKFTIA 120

Query: 587 NLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLS 646
              F+  DGIFG+A+SP                                D R +YFH L+
Sbjct: 121 GESFQLDDGIFGLALSP-----------------------------RTPDGRTLYFHPLA 151

Query: 647 SNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHS 706
           S R Y V T  LRN + + N++  ++ F  LG   RNTQ++A A++ NGV+F+ LV +++
Sbjct: 152 STRLYSVPTEVLRNETNWGNNAQYED-FKDLGD--RNTQSTALAVDPNGVLFFGLVGQNA 208

Query: 707 VGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYGFLDFNVY 766
           VGCWNT +  Y      +V  + D L FP+DLKID  + +W+LSN++ ++LY  LD++  
Sbjct: 209 VGCWNT-STPYSRANLGVVARNSDTLQFPSDLKIDKEEYLWVLSNRMQKFLYNDLDYDEV 267

Query: 767 NYRILVANSNDIKNN 781
           N+RIL AN + +  N
Sbjct: 268 NFRILGANVDLLIRN 282

Royal jelly is the food of queen bee larvae, and is responsible for the high reproductive ability of the queen. Major royal jelly proteins make up around 90% of larval jelly proteins. This family also the sequence-related yellow protein of drosophila which controls pigmentation of the adult cuticle and larval mouth parts. Length = 285
>gnl|CDD|217322 pfam03022, MRJP, Major royal jelly protein Back     alignment and domain information
>gnl|CDD|217322 pfam03022, MRJP, Major royal jelly protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1228
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 100.0
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 100.0
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.17
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.02
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.77
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.53
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.46
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 98.26
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.23
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 98.21
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.48
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.41
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.17
PRK11028330 6-phosphogluconolactonase; Provisional 97.14
PRK11028330 6-phosphogluconolactonase; Provisional 97.14
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.99
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.77
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.76
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.66
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.5
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.45
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.44
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.35
KOG4659|consensus 1899 96.14
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 96.12
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 96.11
COG3391381 Uncharacterized conserved protein [Function unknow 95.95
COG3391381 Uncharacterized conserved protein [Function unknow 95.72
PRK02888 635 nitrous-oxide reductase; Validated 95.54
KOG4499|consensus310 94.96
KOG4659|consensus 1899 94.8
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 94.79
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 94.58
PRK02888635 nitrous-oxide reductase; Validated 94.3
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 94.11
COG3204316 Uncharacterized protein conserved in bacteria [Fun 93.9
COG3204316 Uncharacterized protein conserved in bacteria [Fun 93.8
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 93.75
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 92.17
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 92.12
KOG1539|consensus910 91.88
KOG1539|consensus 910 91.36
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 91.3
KOG4499|consensus310 91.17
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 90.57
KOG1214|consensus1289 90.47
KOG1520|consensus376 89.59
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 89.49
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 89.13
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 88.08
KOG1520|consensus376 87.42
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 87.39
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 86.87
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 86.38
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 85.52
KOG1214|consensus 1289 85.49
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 85.39
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 84.28
PF13449326 Phytase-like: Esterase-like activity of phytase 83.84
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 83.64
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 81.93
PRK04043419 tolB translocation protein TolB; Provisional 81.35
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 80.34
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 80.19
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information 
Probab=100.00  E-value=1.4e-68  Score=602.30  Aligned_cols=284  Identities=37%  Similarity=0.741  Sum_probs=238.6

Q ss_pred             eEEEEEEEecCCeEEEeecCcccccCCCceecCCeEEEEEccCCcEEEEEEcCCcccccCCcccceEEEEe-ecCCceEE
Q psy11781         28 ISVFRMSVDKCDRLWIMDTGVTNILSSIQQLCPPKIMVFDLKTNTLIRKYILPTAQVFEGSLFSNIVTEVV-EDCDHVFA  106 (1228)
Q Consensus        28 ~~v~~~~~d~~~~lw~ldtg~~~~~~~~~~~~~pkl~~~dl~t~~~~~~~~~p~~~~~~~s~~~~i~~d~~-~~~~~~~a  106 (1228)
                      +|||+++||+||||||||+|+++..+.+.+.||||||+|||+||++++||.||++++.++|+++|+|+|.. .+|+++||
T Consensus         1 ~sV~~v~iD~~~rLWVlD~G~~~~~~~~~~~~~pKLv~~Dl~t~~li~~~~~p~~~~~~~s~lndl~VD~~~~~~~~~~a   80 (287)
T PF03022_consen    1 VSVQRVQIDECGRLWVLDSGRPNGLQPPKQVCPPKLVAFDLKTNQLIRRYPFPPDIAPPDSFLNDLVVDVRDGNCDDGFA   80 (287)
T ss_dssp             S-EEEEEE-TTSEEEEEE-CCHSSSSTTGHTS--EEEEEETTTTCEEEEEE--CCCS-TCGGEEEEEEECTTTTS-SEEE
T ss_pred             CcccEEEEcCCCCEEEEeCCCcCCCCCCCCCCCcEEEEEECCCCcEEEEEECChHHcccccccceEEEEccCCCCcceEE
Confidence            68999999999999999999999777778899999999999999999999999999999999999999984 57999999


Q ss_pred             EEeeCCcceEEEEEccCCceeeeecCccccCCCccceeeccceeeeccCeeeeecCcCCCCccccCCcccccccccccCC
Q psy11781        107 YVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNG  186 (1228)
Q Consensus       107 Yi~D~~~~g~iv~dl~~~~swR~~h~~~~~~p~~~~~~~~~~~f~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g  186 (1228)
                      ||||++.+||||||+.+|+|||+.|+++.++|.+..|+++|+.|+|.+|++|+++++.                      
T Consensus        81 YItD~~~~glIV~dl~~~~s~Rv~~~~~~~~p~~~~~~i~g~~~~~~dg~~gial~~~----------------------  138 (287)
T PF03022_consen   81 YITDSGGPGLIVYDLATGKSWRVLHNSFSPDPDAGPFTIGGESFQWPDGIFGIALSPI----------------------  138 (287)
T ss_dssp             EEEETTTCEEEEEETTTTEEEEEETCGCTTS-SSEEEEETTEEEEETTSEEEEEE-TT----------------------
T ss_pred             EEeCCCcCcEEEEEccCCcEEEEecCCcceeccccceeccCceEecCCCccccccCCC----------------------
Confidence            9999999999999999999999999999999999999999999999999999999974                      


Q ss_pred             CcccccccCCCceEEEEecccCeeEEEecccccCCcccCCccchhhhhhhcCccccccccceeeEcCCCeEEEeccCCCe
Q psy11781        187 TNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHS  266 (1228)
Q Consensus       187 ~~~~~~~~~~~~~lYf~~lsS~~~~sV~T~~Lr~~~~~~~~~~~~~~v~~~G~rg~~sqs~~~~~d~~Gvi~f~~v~~~a  266 (1228)
                             ++|||+||||||+|++||+|||++||+++.... .++.+.|+.+|+||  +|++|+++|++|+|||++++++|
T Consensus       139 -------~~d~r~LYf~~lss~~ly~v~T~~L~~~~~~~~-~~~~~~v~~lG~k~--~~s~g~~~D~~G~ly~~~~~~~a  208 (287)
T PF03022_consen  139 -------SPDGRWLYFHPLSSRKLYRVPTSVLRDPSLSDA-QALASQVQDLGDKG--SQSDGMAIDPNGNLYFTDVEQNA  208 (287)
T ss_dssp             -------STTS-EEEEEETT-SEEEEEEHHHHCSTT--HH-H-HHHT-EEEEE-----SECEEEEETTTEEEEEECCCTE
T ss_pred             -------CCCccEEEEEeCCCCcEEEEEHHHhhCcccccc-ccccccceeccccC--CCCceEEECCCCcEEEecCCCCe
Confidence                   356899999999999999999999999987532 22567899999998  69999999999999999999999


Q ss_pred             eEEEeCCCCcccccccceeecccceeecCcceeeeC--CCeEEEEeccccchhcccCCCceeeEEEEEecccccccCCCC
Q psy11781        267 VGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDP--NDNIWILSNKLHQYLYGFLDFNVYNYRILVANSNDISNAGPA  344 (1228)
Q Consensus       267 I~cwn~~~~~~~~~~~~~v~~~~~~l~~p~~l~i~~--~g~lw~~sn~l~~~~~~~l~~~~~n~ri~~~~~~~~~~~~~~  344 (1228)
                      |+|||+.+ +|++++..+|+++.++|+||++|+|++  +|+||+++||||+|+++.|+++|+||||++++++++|+||+|
T Consensus       209 I~~w~~~~-~~~~~~~~~l~~d~~~l~~pd~~~i~~~~~g~L~v~snrl~~~~~~~~~~~e~nfri~~~~v~~~~~~t~C  287 (287)
T PF03022_consen  209 IGCWDPDG-PYTPENFEILAQDPRTLQWPDGLKIDPEGDGYLWVLSNRLQRFAYGNLNPDEVNFRIWRARVDELIKGTVC  287 (287)
T ss_dssp             EEEEETTT-SB-GCCEEEEEE-CC-GSSEEEEEE-T--TS-EEEEE-S--SSTGGG---SS-SEEEEES-HHHHHTTSTT
T ss_pred             EEEEeCCC-CcCccchheeEEcCceeeccceeeeccccCceEEEEECcchHhhccCCCCCccEEeEEEeCHHHHhcCCCC
Confidence            99999996 779999999999998999999999999  999999999999999999999999999999999999999999

5% of the mass, and 82-90% of the protein content [], of honeybee (Apis mellifera) royal jelly. Royal jelly is a substance secreted by the cephalic glands of nurse bees [] and it is used to trigger development of a queen bee from a bee larva. The biological function of the MRJPs is unknown, but they are believed to play a major role in nutrition due to their high essential amino acid content []. Two royal jelly proteins, MRJP3 and MRJP5, contain a tandem repeat that results from a high genetic variablility. This polymorphism may be useful for genotyping individual bees [].; PDB: 3Q6P_B 3Q6K_A 3Q6T_A 2QE8_B.
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1228
3q6k_A381 Salivary Protein From Lutzomyia Longipalpis Length 9e-21
3q6k_A381 Salivary Protein From Lutzomyia Longipalpis Length 9e-21
3q6p_A381 Salivary Protein From Lutzomyia Longipalpis. Seleno 1e-20
3q6p_A381 Salivary Protein From Lutzomyia Longipalpis. Seleno 1e-20
>pdb|3Q6K|A Chain A, Salivary Protein From Lutzomyia Longipalpis Length = 381 Back     alignment and structure 
Iteration: 1

 Score = 99.8 bits (247), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 86/346 (24%), Positives = 141/346 (40%), Gaps = 58/346 (16%)
Query: 421 IFLSFPKWKAGIPFTLASFNMNDP-----SESPILLPYPNWSYFDDSNCNSLISVFRMSV 475
           +FL+ P+    +P+TLA  +  +        SP+L  +             L S+++  +
Sbjct: 40  LFLAVPRKLPRVPYTLAEVDTKNSLGVKGKHSPLLNKFSG-----HKTGKELTSIYQPVI 94
Query: 476 DKCDRLWIMDTGVTNILSSIQQLCP---PKIMVFDLKTNTL--IRKYILPTAQVFEGSLF 530
           D C RLW++D G     S   +  P   P I+ +DLK      + +Y  PT  V + + F
Sbjct: 95  DDCRRLWVVDIGSVEYRSRGAKDYPSHRPAIVAYDLKQPNYPEVVRYYFPTRLVEKPTYF 154
Query: 531 SNIVTEVVE---DCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPE-PTQSTYILD 586
                +V     DC   F Y+ +  R  L +YD  K  S+ +THP    E PT+  Y   
Sbjct: 155 GGFAVDVANPKGDCSETFVYITNFLRGALFIYDHKKQDSWNVTHPTFKAERPTKFDYGGK 214
Query: 587 NLKFRWVDGIFGMAISPELSGKYKRXXXXXXXXXXXXXNGTNVDKTIRDDQRYMYFHSLS 646
             +F+   GIFG+ +    S                            +  R  Y+ + S
Sbjct: 215 EYEFK--AGIFGITLGDRDS----------------------------EGNRPAYYLAGS 244
Query: 647 SNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAIN-SNGVMFYNLVTKH 705
           + + Y V+T +L+     +N          LG+R +   A A A +    V+F+      
Sbjct: 245 AIKVYSVNTKELKQKGGKLNP-------ELLGNRGKYNDAIALAYDPKTKVIFFAEANTK 297
Query: 706 SVGCWNTKTKVYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSN 751
            V CWNT+      +  D+V TS   + F  D+ +D    +W +SN
Sbjct: 298 QVSCWNTQKMPLRMKNTDVVYTSSRFV-FGTDISVDSKGGLWFMSN 342
>pdb|3Q6K|A Chain A, Salivary Protein From Lutzomyia Longipalpis Length = 381 Back     alignment and structure
>pdb|3Q6P|A Chain A, Salivary Protein From Lutzomyia Longipalpis. Selenomethionine Derivative Length = 381 Back     alignment and structure
>pdb|3Q6P|A Chain A, Salivary Protein From Lutzomyia Longipalpis. Selenomethionine Derivative Length = 381 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1228
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 6e-88
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 1e-87
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 3e-71
2qe8_A343 Uncharacterized protein; structural genomics, join 1e-49
2qe8_A343 Uncharacterized protein; structural genomics, join 1e-49
2qe8_A343 Uncharacterized protein; structural genomics, join 1e-44
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Length = 381 Back     alignment and structure
 Score =  288 bits (739), Expect = 6e-88
 Identities = 88/421 (20%), Positives = 160/421 (38%), Gaps = 69/421 (16%)

Query: 379 VFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGI--WRSTIFLSFPKWKAGIPFTL 436
            ++WK + +           +    + P+N +            +FL+ P+    +P+TL
Sbjct: 5   GYKWKQLLYNN---------VTPGSYNPDNMISTAFAYDAEGEKLFLAVPRKLPRVPYTL 55

Query: 437 ASFNMND-----PSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNI 491
           A  +  +        SP+L  +             L S+++  +D C RLW++D G    
Sbjct: 56  AEVDTKNSLGVKGKHSPLLNKFSGHK-----TGKELTSIYQPVIDDCRRLWVVDIGSVEY 110

Query: 492 LSSIQQLCP---PKIMVFDLKTNTL--IRKYILPTAQVFEGSLFSNIVTEVV---EDCDH 543
            S   +  P   P I+ +DLK      + +Y  PT  V + + F     +V     DC  
Sbjct: 111 RSRGAKDYPSHRPAIVAYDLKQPNYPEVVRYYFPTRLVEKPTYFGGFAVDVANPKGDCSE 170

Query: 544 VFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMAISP 603
            F Y+ +  R  L +YD  K  S+ +THP    E   + +     ++ +  GIFG+ +  
Sbjct: 171 TFVYITNFLRGALFIYDHKKQDSWNVTHPTFKAERP-TKFDYGGKEYEFKAGIFGITLGD 229

Query: 604 ELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSR 663
             S                            +  R  Y+ + S+ + Y V+T +L+    
Sbjct: 230 RDS----------------------------EGNRPAYYLAGSAIKVYSVNTKELKQKGG 261

Query: 664 YVNSSDIDEYFHYLGSRFRNTQASASAINS-NGVMFYNLVTKHSVGCWNTKTKVYLPQTQ 722
            +N          LG+R +   A A A +    V+F+       V CWNT+      +  
Sbjct: 262 KLN-------PELLGNRGKYNDAIALAYDPKTKVIFFAEANTKQVSCWNTQKMPLRMKNT 314

Query: 723 DIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLYG-FLDFNVYNYRIL-VANSNDIKN 780
           D+V TS     F  D+ +D    +W +SN            ++   YR++ + ++ +   
Sbjct: 315 DVVYTSSR-FVFGTDISVDSKGGLWFMSNGFPPIRKSEKFKYDFPRYRLMRIMDTQEAIA 373

Query: 781 N 781
            
Sbjct: 374 G 374
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Length = 381 Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Length = 381 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Length = 343 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Length = 343 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Length = 343 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1228
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 100.0
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 100.0
2qe8_A343 Uncharacterized protein; structural genomics, join 100.0
2qe8_A343 Uncharacterized protein; structural genomics, join 100.0
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 99.53
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.49
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.48
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 99.45
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.29
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.27
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.24
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.18
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.17
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.09
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.06
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.99
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.98
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.98
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.94
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.92
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.9
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.88
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.84
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.84
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.83
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.83
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.82
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.78
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.78
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.77
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.77
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.76
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.76
3v65_B386 Low-density lipoprotein receptor-related protein; 98.75
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.74
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.74
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.74
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.71
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.71
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.7
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.69
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.69
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.68
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.68
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.68
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.67
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.66
3v65_B386 Low-density lipoprotein receptor-related protein; 98.66
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.63
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.62
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.61
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.6
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.59
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.58
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.57
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.53
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.53
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.51
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.5
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.5
3kya_A496 Putative phosphatase; structural genomics, joint c 98.49
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.49
3kya_A496 Putative phosphatase; structural genomics, joint c 98.46
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.45
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.43
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.43
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.42
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.38
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.37
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.36
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.34
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.32
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.29
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.22
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.17
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.1
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.1
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.08
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.04
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.99
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.93
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.92
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.85
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.8
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.73
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.72
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.7
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.68
3ott_A758 Two-component system sensor histidine kinase; beta 97.68
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.55
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.49
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.48
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.45
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.45
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.41
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.4
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.39
3ott_A758 Two-component system sensor histidine kinase; beta 97.39
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.38
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.37
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.35
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.34
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.32
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.29
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.28
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.27
2ece_A462 462AA long hypothetical selenium-binding protein; 97.27
2ece_A462 462AA long hypothetical selenium-binding protein; 97.22
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.14
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.07
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.98
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 96.95
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.93
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 96.83
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 96.82
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 96.6
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 96.55
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 96.55
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 96.54
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 96.53
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 96.49
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 96.48
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.42
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.35
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 96.35
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 96.17
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 96.09
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 96.06
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 95.9
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 95.72
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 95.66
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 95.22
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 94.22
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 93.93
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 93.84
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 93.77
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 93.7
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 92.59
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 92.42
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 92.1
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 91.7
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 91.07
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 91.01
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 90.5
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 90.39
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 90.32
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 90.08
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 89.96
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 89.94
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 89.29
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 88.91
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 88.55
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 87.8
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 87.45
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 86.86
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 86.53
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 85.75
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 85.5
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 85.02
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 84.48
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 83.98
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 83.56
3ow8_A321 WD repeat-containing protein 61; structural genomi 83.05
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 82.93
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 82.37
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 82.09
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 81.62
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 81.57
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 81.55
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 81.19
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 80.82
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 80.45
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 80.11
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
Probab=100.00  E-value=3.1e-87  Score=775.89  Aligned_cols=359  Identities=24%  Similarity=0.461  Sum_probs=336.7

Q ss_pred             ceEEEEEeeeeeecCCHHHHHhhccCCCcccCCCcccceEE--eCCeEEEEcccCCCCCCcEEEEEECCCCC----CCCc
Q psy11781        376 FQVVFRWKIMDFVFRDNKQKANLIRSNKFIPENNLPLGIGI--WRSTIFLSFPKWKAGIPFTLASFNMNDPS----ESPI  449 (1228)
Q Consensus       376 l~~v~~Wk~ldf~~p~~~~r~~ai~~g~y~p~n~~P~gv~v--~~gRiFvt~PR~~~gvP~TL~~v~~~~~~----~sp~  449 (1228)
                      ++++||||+|||+         ||++|.|+|+|++|+||++  ++||+|||+|||+.|+|+||++|.....+    .+|+
T Consensus         2 ~~~~~~Wk~ld~~---------ai~~g~y~p~n~~P~gv~vd~~~gRiFvt~PR~~~gvp~TL~~v~~~~~~~~~~~~p~   72 (381)
T 3q6k_A            2 DTQGYKWKQLLYN---------NVTPGSYNPDNMISTAFAYDAEGEKLFLAVPRKLPRVPYTLAEVDTKNSLGVKGKHSP   72 (381)
T ss_dssp             CCEEEEESSCCBT---------TSCTTSSCGGGCCCCEEEEETTTTEEEEECCTTSTTCSCSEEEEEHHHHTTCTTCSSC
T ss_pred             cceEEEEEeeccc---------cccCCCcccCccceeeeeeecCCCcEEEEeCCCCCCCCcEEEEEeCCCCcccccCCcc
Confidence            6899999999995         9999999999999999999  79999999999999999999999864322    3788


Q ss_pred             c-cCCCCcCcCCCCCCCcceEEEEEEEeCCCcEEEEeCCCCCcccCcCc---cCCCEEEEEECCCC--cEEEEEECCCcc
Q psy11781        450 L-LPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMDTGVTNILSSIQQ---LCPPKIMVFDLKTN--TLIRKYILPTAQ  523 (1228)
Q Consensus       450 l-~PYP~~~wn~~~~c~~lvsV~~v~iD~~gRLWVLDtG~~~~~~~~~~---~~~PKLvvfDL~td--~vi~~y~~p~~v  523 (1228)
                      | +|||+|     ++|++|+||++++||+||||||||+|.++..+++.|   .|+|||++|||+||  +++|+|+||+++
T Consensus        73 ll~PYP~w-----~~~~~lvsV~~v~iD~~~rLWVLDtG~~~~~~~~~~~~~~~~pkLv~~DL~t~~~~li~~y~~p~~~  147 (381)
T 3q6k_A           73 LLNKFSGH-----KTGKELTSIYQPVIDDCRRLWVVDIGSVEYRSRGAKDYPSHRPAIVAYDLKQPNYPEVVRYYFPTRL  147 (381)
T ss_dssp             CBEECTTC-----SSSCSSSCEEEEEECTTCEEEEEECSSCSSCSTTGGGSCCCCCEEEEEESSSTTCCEEEEEECCGGG
T ss_pred             cccCCCCC-----ccccceEEeeEEEEcCCCcEEEEeCCCcCcCCCccccCCCCCceEEEEECCCCCceeEEEEECCHHh
Confidence            8 999998     579999999999999999999999999998887778   99999999999999  999999999999


Q ss_pred             cccCCCceeEEEEeec---CCCCeEEEEecCCCCeEEEEEcCCCeEEEEcCCCCCcCCCCcceEEcCeEeeecCCcceee
Q psy11781        524 VFEGSLFSNIVTEVVE---DCDHVFAYVNDVFRYGLIVYDFFKNTSYRLTHPYMYPEPTQSTYILDNLKFRWVDGIFGMA  600 (1228)
Q Consensus       524 ~~~~S~l~di~VD~~~---~c~~~~aYItDs~~~gLIVyDl~~g~swRv~~~s~~pdP~~~~~~i~G~~f~~~dGi~GIA  600 (1228)
                      ++++|+|++|+||+..   +|+++||||||++.+||||||+++|++|||+|++|+|+ .++.|+++|++|+|++|++|||
T Consensus       148 ~~~~S~l~di~VD~~~~~~~c~~~~aYItD~~~~gLIVydl~~~~swRv~~~~~~pd-~~~~~~i~G~~~~~~~Gi~gIa  226 (381)
T 3q6k_A          148 VEKPTYFGGFAVDVANPKGDCSETFVYITNFLRGALFIYDHKKQDSWNVTHPTFKAE-RPTKFDYGGKEYEFKAGIFGIT  226 (381)
T ss_dssp             CCCGGGEEEEEEEESCTTTTSCSEEEEEEETTTTEEEEEETTTTEEEEEECGGGSCC-SCEEEEETTEEEEECCCEEEEE
T ss_pred             cccCCccceEEEecccCCCCCCccEEEEEcCCCCcEEEEECCCCcEEEEccCCCccc-cCcceEECCEEeEeccCceEEE
Confidence            9999999999999643   79999999999999999999999999999999999999 6679999999999999999999


Q ss_pred             cCcccCCcccCCCccccccccccccCccccccccCCCceEEEeeCCCCceEEEechhhcCCCCCCCccccccceEeeccc
Q psy11781        601 ISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYFHSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSR  680 (1228)
Q Consensus       601 Lsp~~~~~~~~~~~~~~~~~~~~~~~~~~~i~is~d~r~LYf~~lss~~ly~V~T~~Lr~~~~~~~~~~~~~~v~~lG~~  680 (1228)
                      |||...+                            ++|+||||||+|++||+|+|++|+++++       ...|+.+|+|
T Consensus       227 Lsp~~~~----------------------------~~~~LYf~plss~~ly~V~T~~L~~~~~-------~~~v~~~G~k  271 (381)
T 3q6k_A          227 LGDRDSE----------------------------GNRPAYYLAGSAIKVYSVNTKELKQKGG-------KLNPELLGNR  271 (381)
T ss_dssp             ECCCCTT----------------------------SCCEEEEEESSCSEEEEEEHHHHSSTTC-------CCCCEEEEEC
T ss_pred             ecCCcCC----------------------------CCeEEEEEECCCCcEEEEEHHHhhCcch-------hhceEEeeec
Confidence            9996432                            5899999999999999999999999873       6789999999


Q ss_pred             cccccccceEEc-cCCcEEEEcCCCCeEEEEeCCCC-ccCCCCeeEEEecCCceecCCceEEcCCCcEEEEecCcccccc
Q psy11781        681 FRNTQASASAIN-SNGVMFYNLVTKHSVGCWNTKTK-VYLPQTQDIVQTSRDILNFPNDLKIDPNDNIWILSNKLHQYLY  758 (1228)
Q Consensus       681 g~~~qs~G~a~D-~~G~LY~t~~~~~aI~~wn~~~~-~~~~~n~~iV~~~d~~L~wPd~l~Id~dg~LyVlsnrl~~~~~  758 (1228)
                      |+.+|+.|+++| ++|+|||+++++++|+|||++ + +|+++++++|++++ +|+||++|+|+.+|+|||++||||+|++
T Consensus       272 g~~s~~~~~~~D~~~G~ly~~~~~~~aI~~w~~~-~~~~~~~n~~~l~~d~-~l~~pd~~~i~~~g~Lwv~sn~l~~~~~  349 (381)
T 3q6k_A          272 GKYNDAIALAYDPKTKVIFFAEANTKQVSCWNTQ-KMPLRMKNTDVVYTSS-RFVFGTDISVDSKGGLWFMSNGFPPIRK  349 (381)
T ss_dssp             CTTCCEEEEEECTTTCEEEEEESSSSEEEEEETT-SCSBCGGGEEEEEECT-TCCSEEEEEECTTSCEEEEECSCCSSTT
T ss_pred             CCCCCcceEEEeCCCCeEEEEeccCCeEEEEeCC-CCccccCceEEEEECC-CccccCeEEECCCCeEEEEECcchHhhc
Confidence            977889999998 999999999999999999999 8 99999999999777 9999999999999999999999999999


Q ss_pred             CCC-CCccccEEEEEE-ecchhccCCCCCC
Q psy11781        759 GFL-DFNVYNYRILVA-NSNDIKNNNQPPN  786 (1228)
Q Consensus       759 ~~~-d~~e~nfrI~r~-~v~~~i~~t~c~~  786 (1228)
                      |++ |.+|+||||||+ +++++|+||+|+.
T Consensus       350 g~l~d~~~~nfrI~r~~~~~~~i~~t~C~~  379 (381)
T 3q6k_A          350 SEKFKYDFPRYRLMRIMDTQEAIAGTACDM  379 (381)
T ss_dssp             GGGCCCSSCSEEEEEESCHHHHHTTSTTSC
T ss_pred             CCcCCCCcCCEEEEEecCHHHHhcCCCCCC
Confidence            999 999999999999 9999999999984
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1228
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.28
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.23
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.0
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.98
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.94
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.91
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.88
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.82
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.81
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.75
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.68
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.55
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.27
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.23
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.19
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.11
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.99
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.99
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.69
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.27
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.07
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.66
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 96.54
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 96.35
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.32
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 96.29
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 96.25
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 96.21
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 96.04
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.04
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 95.47
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 95.41
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 95.12
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.91
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 94.77
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 93.86
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 93.78
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 93.23
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 93.21
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 92.66
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 91.89
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 91.45
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 91.39
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 90.19
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 86.04
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 84.39
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 82.82
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 81.21
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Calcium-dependent phosphotriesterase
family: All0351-like
domain: Hypothetical protein All0351 homologue
species: Nostoc punctiforme [TaxId: 272131]

Probab=99.28  E-value=1.8e-09  Score=117.69  Aligned_cols=261  Identities=11%  Similarity=0.048  Sum_probs=171.2

Q ss_pred             CCCcccceEEe-CCeEEEEcccCCCCCCcEEEEEECCCCCCCCcccCCCCcCcCCCCCCCcceEEEEEEEeCCCcEEEEe
Q psy11781        407 ENNLPLGIGIW-RSTIFLSFPKWKAGIPFTLASFNMNDPSESPILLPYPNWSYFDDSNCNSLISVFRMSVDKCDRLWIMD  485 (1228)
Q Consensus       407 ~n~~P~gv~v~-~gRiFvt~PR~~~gvP~TL~~v~~~~~~~sp~l~PYP~~~wn~~~~c~~lvsV~~v~iD~~gRLWVLD  485 (1228)
                      .+..|.|+++. +||||+|-..     .-++-.++..     +..+.++..          --.+.++.+|++|+|||.+
T Consensus        26 ~~~~~e~iAv~pdG~l~vt~~~-----~~~I~~i~p~-----g~~~~~~~~----------~~~~~gla~~~dG~l~v~~   85 (302)
T d2p4oa1          26 VNTFLENLASAPDGTIFVTNHE-----VGEIVSITPD-----GNQQIHATV----------EGKVSGLAFTSNGDLVATG   85 (302)
T ss_dssp             TTCCEEEEEECTTSCEEEEETT-----TTEEEEECTT-----CCEEEEEEC----------SSEEEEEEECTTSCEEEEE
T ss_pred             CCCCcCCEEECCCCCEEEEeCC-----CCEEEEEeCC-----CCEEEEEcC----------CCCcceEEEcCCCCeEEEe
Confidence            34567899997 7999999654     2267777642     233333211          1257889999999999998


Q ss_pred             CCCCCcccCcCccCCCEEEEEEC--CCCcEEEEEECCCcccccCCCceeEEEEeecCCCCeEEEEecCCCCeEEEEEcCC
Q psy11781        486 TGVTNILSSIQQLCPPKIMVFDL--KTNTLIRKYILPTAQVFEGSLFSNIVTEVVEDCDHVFAYVNDVFRYGLIVYDFFK  563 (1228)
Q Consensus       486 tG~~~~~~~~~~~~~PKLvvfDL--~td~vi~~y~~p~~v~~~~S~l~di~VD~~~~c~~~~aYItDs~~~gLIVyDl~~  563 (1228)
                      .+.-.            |.++++  .+++..+....+.     ....+++++|     .++.+|++|+....+..+|..+
T Consensus        86 ~~~~~------------~~~~~~~~~~~~~~~~~~~~~-----~~~~n~i~~~-----~~g~~~v~~~~~~~i~~~~~~~  143 (302)
T d2p4oa1          86 WNADS------------IPVVSLVKSDGTVETLLTLPD-----AIFLNGITPL-----SDTQYLTADSYRGAIWLIDVVQ  143 (302)
T ss_dssp             ECTTS------------CEEEEEECTTSCEEEEEECTT-----CSCEEEEEES-----SSSEEEEEETTTTEEEEEETTT
T ss_pred             cCCce------------EEEEEecccccceeeccccCC-----ccccceeEEc-----cCCCEEeeccccccceeeeccC
Confidence            76432            444443  3455554445533     4678999998     5789999999999999999999


Q ss_pred             CeEEEEcCC-CCCcCCCCcceEEcCeEeeecCCcceeecCcccCCcccCCCccccccccccccCccccccccCCCceEEE
Q psy11781        564 NTSYRLTHP-YMYPEPTQSTYILDNLKFRWVDGIFGMAISPELSGKYKRHPYEYYHYNVHHYNGTNVDKTIRDDQRYMYF  642 (1228)
Q Consensus       564 g~swRv~~~-s~~pdP~~~~~~i~G~~f~~~dGi~GIALsp~~~~~~~~~~~~~~~~~~~~~~~~~~~i~is~d~r~LYf  642 (1228)
                      +..+.+... ...+.....          ......||+.                                  +++.||+
T Consensus       144 ~~~~~~~~~~~~~~~~~~~----------~~~~~ngi~~----------------------------------~~~~l~~  179 (302)
T d2p4oa1         144 PSGSIWLEHPMLARSNSES----------VFPAANGLKR----------------------------------FGNFLYV  179 (302)
T ss_dssp             TEEEEEEECGGGSCSSTTC----------CSCSEEEEEE----------------------------------ETTEEEE
T ss_pred             CcceeEecCCccceeeccC----------cccccccccc----------------------------------cCCceee
Confidence            887776632 111110000          0011223322                                  4568999


Q ss_pred             eeCCCCceEEEechhhcCCCCCCCccccccceEeeccccccccccceEEccCCcEEEEcCCCCeEEEEeCCCCccCCCCe
Q psy11781        643 HSLSSNRHYYVSTTDLRNSSRYVNSSDIDEYFHYLGSRFRNTQASASAINSNGVMFYNLVTKHSVGCWNTKTKVYLPQTQ  722 (1228)
Q Consensus       643 ~~lss~~ly~V~T~~Lr~~~~~~~~~~~~~~v~~lG~~g~~~qs~G~a~D~~G~LY~t~~~~~aI~~wn~~~~~~~~~n~  722 (1228)
                      ......++++++.....  ..       . ......+.   ...+|+++|++|+||++....++|.+++++ ++     .
T Consensus       180 ~~~~~~~i~~~~~~~~~--~~-------~-~~~~~~~~---~~pdgia~d~dG~l~va~~~~~~V~~i~p~-G~-----~  240 (302)
T d2p4oa1         180 SNTEKMLLLRIPVDSTD--KP-------G-EPEIFVEQ---TNIDDFAFDVEGNLYGATHIYNSVVRIAPD-RS-----T  240 (302)
T ss_dssp             EETTTTEEEEEEBCTTS--CB-------C-CCEEEEES---CCCSSEEEBTTCCEEEECBTTCCEEEECTT-CC-----E
T ss_pred             ecCCCCeEEeccccccc--cc-------c-ccccccCC---CCCcceEECCCCCEEEEEcCCCcEEEECCC-CC-----E
Confidence            99999999999863321  11       0 11111111   247999999999999999999999999998 43     3


Q ss_pred             eEEEecCCceecCCceEEcC---CC-cEEEEecCccccccCCCCCccccEEEEEEec
Q psy11781        723 DIVQTSRDILNFPNDLKIDP---ND-NIWILSNKLHQYLYGFLDFNVYNYRILVANS  775 (1228)
Q Consensus       723 ~iV~~~d~~L~wPd~l~Id~---dg-~LyVlsnrl~~~~~~~~d~~e~nfrI~r~~v  775 (1228)
                      ..++.....+.+|+.++++.   |+ .|||.++.-.....   .....+-+|+++++
T Consensus       241 ~~~~~~~~~~~~pt~vafg~~~~D~~~Lyvtt~~g~~~~~---~~~~~~~~~~~~~~  294 (302)
T d2p4oa1         241 TIIAQAEQGVIGSTAVAFGQTEGDCTAIYVVTNGGMFLPP---PTGVVPANVVRLEV  294 (302)
T ss_dssp             EEEECGGGTCTTEEEEEECCSTTTTTEEEEEECTTSSSCC---TTCCCCEEEEEEEC
T ss_pred             EEEEecCCCCCCceEEEEcCCCCCCCEEEEECCCCccCCC---cCCcCCCeEEEEeC
Confidence            45555555788999999963   44 59999987433221   22456689999886
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure