Diaphorina citri psyllid: psy11784


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----
SEANDLALQLARAYTGRQNIVVVDAAYHGTVNLLLDISPRAFMLSSEKKPWVHVIPFPDTYRGEFSADDPQAAQKYAQAARNIMEAHRDNIATLICEPVFVVHGAVVPPPGWLSLMYDYIHEIGGVVIADEIQCGMGRSGSHFWAFQTQGAVPDIITVGKPMGNGMPIGAVITSRKIAESLNCLDDNRPSGKYLVRPLGINLHIFWCLILLSITYYLYRYTRRMKEAKIIVANEGEYGNVLLFLPAMCLTTENVLFIVSTLNRIFTSLQMDSSPAIMDLLLPRT
ccHHHHHHHHHHHHcccccEEEEccccccHHHHHHHcccccccccccccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHHHHccEEEEcccccccccccccccccccccccccEEEcccccccccccHHHcccHHHHHHccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHccEEEEcccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccc
SEANDLALQLARAYTGRQNIVVVDAAYHGTVNLLLDISPRAFMLSSEKKPWVHVIPFPDTYRGEFSADDPQAAQKYAQAARNIMEAHRDNIATLICEPVFVVHGAVVPPPGWLSLMYDYIHEIGGVVIADEIQCGMGRSGSHFWAFQTQGAVPDIITVGKPMGNGMPIGAVITSRKIAESLNCLDDNRPSGKYLVRPLGINLHIFWCLILLSITYYLYRYTRRMKEAKIIVANEGEYGNVLLFLPAMCLTTENVLFIVSTLNRIFTSLQM**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SEANDLALQLARAYTGRQNIVVVDAAYHGTVNLLLDISPRAFMLSSEKKPWVHVIPFPDTYRGEFSADDPQAAQKYAQAARNIMEAHRDNIATLICEPVFVVHGAVVPPPGWLSLMYDYIHEIGGVVIADEIQCGMGRSGSHFWAFQTQGAVPDIITVGKPMGNGMPIGAVITSRKIAESLNCLDDNRPSGKYLVRPLGINLHIFWCLILLSITYYLYRYTRRMKEAKIIVANEGEYGNVLLFLPAMCLTTENVLFIVSTLNRIFTSLQMDSSPAIMDLLLPRT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003674 [MF]molecular_functionprobable
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:1901606 [BP]alpha-amino acid catabolic processprobableGO:0019752, GO:0009063, GO:0006807, GO:0044281, GO:0044282, GO:0044712, GO:1901575, GO:0006520, GO:0071704, GO:1901605, GO:0009987, GO:0044710, GO:0008150, GO:0008152, GO:0043436, GO:0009056, GO:0044248, GO:0044238, GO:1901564, GO:1901565, GO:0006082, GO:0046395, GO:0016054, GO:0044237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GJU, chain A
Confidence level:very confident
Coverage over the Query: 1-269
View the alignment between query and template
View the model in PyMOL