Diaphorina citri psyllid: psy11786


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MNKNKAFSRLMIFNSIHGPICQRLVAEVVACEWLLTKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIYAEKISESHPKSLN
ccHHHHHHHHHHHHHccccEEEEEccccccEEEEEcHHHHHHHHHHHHHHHHHccccccEEEEEccccccEEEEEEEEcccccEEEEcccccccHHEEEHHccccccc
*****AFSRLMIFNSIHGPICQRLVAEVVACEWLLTKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIYAEKISESHP****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKNKAFSRLMIFNSIHGPICQRLVAEVVACEWLLTKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIYAEKISESHPKSLN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial confidentQ42523
Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial confidentQ2QMG2
Biotin carboxylase This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.confidentQ06862

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022626 [CC]cytosolic ribosomeprobableGO:0005737, GO:0032991, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0043228, GO:0005622, GO:0043226
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0050897 [MF]cobalt ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006552 [BP]leucine catabolic processprobableGO:0019752, GO:0044248, GO:0006807, GO:0044281, GO:0044282, GO:0044712, GO:1901575, GO:0006520, GO:0071704, GO:1901605, GO:1901606, GO:0009063, GO:0009987, GO:0044710, GO:0008150, GO:0008152, GO:0043436, GO:0009056, GO:0044238, GO:1901564, GO:1901565, GO:0006082, GO:0046395, GO:0016054, GO:0044237, GO:0006551, GO:0009081, GO:0009083
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0004485 [MF]methylcrotonoyl-CoA carboxylase activityprobableGO:0016874, GO:0003674, GO:0016885, GO:0016421, GO:0003824
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VPQ, chain A
Confidence level:very confident
Coverage over the Query: 5-106
View the alignment between query and template
View the model in PyMOL