Psyllid ID: psy11786

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MNKNKAFSRLMIFNSIHGPICQRLVAEVVACEWLLTKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIYAEKISESHPKSLN
ccHHHHHHHHHHHHHccccEEEEEccccccEEEEEcHHHHHHHHHHHHHHHHHccccccEEEEEccccccEEEEEEEEcccccEEEEcccccccHHEEEHHccccccc
ccccccHHHHHHHHHccccEEEEEccccccEEEEccHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEEcccccEEEEccccccHHHHHHEEccccccc
MNKNKAFSRLMIFNSIHGPICQRLVAEVVACEWLLTKDAIEENFKragpklwlffgkddmlvekdigrprhiEVQILGdkygdvvhlydrdcpiyaekiseshpksln
MNKNKAFSRLMIFNSIHGPICQRLVAEVVACEWLLTKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIyaekiseshpksln
MNKNKAFSRLMIFNSIHGPICQRLVAEVVACEWLLTKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIYAEKISESHPKSLN
******FSRLMIFNSIHGPICQRLVAEVVACEWLLTKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIYAE***********
*****AF**LMIFNSIHGPICQRLVAEVVACEWLLTKDAIEEN**********FFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIYAEKISESHPK***
MNKNKAFSRLMIFNSIHGPICQRLVAEVVACEWLLTKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIYAEKI*********
****KAFSRLMIFNSIHGPICQRLVAEVVACEWLLTKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIYAEKISESHP****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKNKAFSRLMIFNSIHGPICQRLVAEVVACEWLLTKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIYAEKISESHPKSLN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query108 2.2.26 [Sep-21-2011]
P11498 1178 Pyruvate carboxylase, mit yes N/A 0.638 0.058 0.478 5e-13
Q29RK2 1178 Pyruvate carboxylase, mit yes N/A 0.638 0.058 0.478 5e-13
Q05920 1178 Pyruvate carboxylase, mit yes N/A 0.638 0.058 0.478 1e-12
P52873 1178 Pyruvate carboxylase, mit yes N/A 0.638 0.058 0.478 1e-12
O17732 1175 Pyruvate carboxylase 1 OS yes N/A 0.620 0.057 0.449 6e-12
Q42777 731 Methylcrotonoyl-CoA carbo yes N/A 0.638 0.094 0.492 2e-11
Q2QMG2 737 Methylcrotonoyl-CoA carbo yes N/A 0.462 0.067 0.557 2e-10
Q9KWU4 1148 Pyruvate carboxylase OS=B yes N/A 0.546 0.051 0.457 2e-10
Q42523 734 Methylcrotonoyl-CoA carbo yes N/A 0.462 0.068 0.576 4e-10
P78992 1189 Pyruvate carboxylase OS=K yes N/A 0.527 0.047 0.438 1e-09
>sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens GN=PC PE=1 SV=2 Back     alignment and function desciption
 Score = 73.2 bits (178), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 34/71 (47%), Positives = 48/71 (67%), Gaps = 2/71 (2%)

Query: 38  DAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIYA- 96
           + +EEN+ RA  +    FG   + VEK I +PRHIEVQILGD+YG+++HLY+RDC I   
Sbjct: 211 EELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRR 270

Query: 97  -EKISESHPKS 106
            +K+ E  P +
Sbjct: 271 HQKVVEIAPAA 281
Pyruvate carboxylase catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second. Catalyzes in a tissue specific manner, the initial reactions of glucose (liver, kidney) and lipid (adipose tissue, liver, brain) synthesis from pyruvate.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 4EC: .EC: 1EC: .EC: 1
>sp|Q29RK2|PYC_BOVIN Pyruvate carboxylase, mitochondrial OS=Bos taurus GN=PC PE=2 SV=2 Back     alignment and function description
>sp|Q05920|PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus GN=Pc PE=1 SV=1 Back     alignment and function description
>sp|P52873|PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus GN=Pc PE=1 SV=2 Back     alignment and function description
>sp|O17732|PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans GN=pyc-1 PE=1 SV=1 Back     alignment and function description
>sp|Q42777|MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max GN=MCCA PE=1 SV=2 Back     alignment and function description
>sp|Q2QMG2|MCCA_ORYSJ Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=MCCA PE=2 SV=2 Back     alignment and function description
>sp|Q9KWU4|PYC_BACSU Pyruvate carboxylase OS=Bacillus subtilis (strain 168) GN=pyc PE=3 SV=1 Back     alignment and function description
>sp|Q42523|MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2 Back     alignment and function description
>sp|P78992|PYC_PICPA Pyruvate carboxylase OS=Komagataella pastoris GN=PYC1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
632808 1178 pyruvate carboxylase [Homo sapiens] 0.638 0.058 0.492 8e-13
195026936 1196 GH21324 [Drosophila grimshawi] gi|193902 0.537 0.048 0.603 2e-12
242025020 1179 pyruvate carboxylase, putative [Pediculu 0.648 0.059 0.513 3e-12
195122837 1143 GI20742 [Drosophila mojavensis] gi|19391 0.527 0.049 0.614 4e-12
410907053 460 PREDICTED: pyruvate carboxylase, mitocho 0.620 0.145 0.507 5e-12
929988 1178 pyruvate carboxylase [Rattus norvegicus] 0.638 0.058 0.492 5e-12
195028269 1197 GH20214 [Drosophila grimshawi] gi|193902 0.527 0.047 0.578 6e-12
270005615 2284 hypothetical protein TcasGA2_TC007694 [T 0.620 0.029 0.507 6e-12
91080283 2228 PREDICTED: similar to carboxylase:pyruva 0.620 0.030 0.507 6e-12
390364224 1167 PREDICTED: pyruvate carboxylase, mitocho 0.546 0.050 0.508 7e-12
>gi|632808|gb|AAB31500.1| pyruvate carboxylase [Homo sapiens] Back     alignment and taxonomy information
 Score = 77.8 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 2/71 (2%)

Query: 38  DAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIYA- 96
           + +EEN+ RA  + W  FG   + VEK I +PRHIEVQILGD+YG+++HLY+RDC I   
Sbjct: 211 EELEENYTRAYSEAWPAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRR 270

Query: 97  -EKISESHPKS 106
            +K+ E  P +
Sbjct: 271 HQKVVEIAPAA 281

Source: Homo sapiens

Species: Homo sapiens

Genus: Homo

Family: Hominidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|195026936|ref|XP_001986371.1| GH21324 [Drosophila grimshawi] gi|193902371|gb|EDW01238.1| GH21324 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|242025020|ref|XP_002432924.1| pyruvate carboxylase, putative [Pediculus humanus corporis] gi|212518433|gb|EEB20186.1| pyruvate carboxylase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195122837|ref|XP_002005917.1| GI20742 [Drosophila mojavensis] gi|193910985|gb|EDW09852.1| GI20742 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|410907053|ref|XP_003967006.1| PREDICTED: pyruvate carboxylase, mitochondrial-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|929988|gb|AAA96256.1| pyruvate carboxylase [Rattus norvegicus] Back     alignment and taxonomy information
>gi|195028269|ref|XP_001986999.1| GH20214 [Drosophila grimshawi] gi|193902999|gb|EDW01866.1| GH20214 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|270005615|gb|EFA02063.1| hypothetical protein TcasGA2_TC007694 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91080283|ref|XP_973877.1| PREDICTED: similar to carboxylase:pyruvate/acetyl-coa/propionyl-coa [Tribolium castaneum] Back     alignment and taxonomy information
>gi|390364224|ref|XP_780258.2| PREDICTED: pyruvate carboxylase, mitochondrial [Strongylocentrotus purpuratus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
UNIPROTKB|F1RUV6341 F1RUV6 "Uncharacterized protei 0.620 0.196 0.507 1.4e-12
ZFIN|ZDB-GENE-000831-1 1181 pc "pyruvate carboxylase" [Dan 0.620 0.056 0.521 1.7e-12
ZFIN|ZDB-GENE-090908-3 1181 pcl "pyruvate carboxylase, lik 0.620 0.056 0.521 1.7e-12
UNIPROTKB|E9PRE7 489 PC "Pyruvate carboxylase, mito 0.620 0.137 0.492 4.3e-12
UNIPROTKB|B4DN00 529 PC "cDNA FLJ60715, highly simi 0.620 0.126 0.492 5e-12
FB|FBgn0027580 1197 CG1516 [Drosophila melanogaste 0.601 0.054 0.522 7.7e-12
UNIPROTKB|Q29RK2 1178 PC "Pyruvate carboxylase, mito 0.620 0.056 0.492 1.6e-11
UNIPROTKB|P11498 1178 PC "Pyruvate carboxylase, mito 0.620 0.056 0.492 1.6e-11
MGI|MGI:97520 1178 Pcx "pyruvate carboxylase" [Mu 0.620 0.056 0.492 1.6e-11
RGD|3262 1178 Pc "pyruvate carboxylase" [Rat 0.620 0.056 0.492 1.6e-11
UNIPROTKB|F1RUV6 F1RUV6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 172 (65.6 bits), Expect = 1.4e-12, P = 1.4e-12
 Identities = 35/69 (50%), Positives = 47/69 (68%)

Query:    38 DAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIYA- 96
             + +EEN+ RA  +    FG   + VEK I +PRHIEVQILGD+YG+V+HLY+RDC I   
Sbjct:   211 EELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNVLHLYERDCSIQRR 270

Query:    97 -EKISESHP 104
              +K+ E  P
Sbjct:   271 HQKVVEIAP 279
GO:0046872 "metal ion binding" evidence=IEA
GO:0006094 "gluconeogenesis" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0004736 "pyruvate carboxylase activity" evidence=IEA
GO:0004075 "biotin carboxylase activity" evidence=IEA
ZFIN|ZDB-GENE-000831-1 pc "pyruvate carboxylase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090908-3 pcl "pyruvate carboxylase, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E9PRE7 PC "Pyruvate carboxylase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DN00 PC "cDNA FLJ60715, highly similar to Pyruvate carboxylase, mitochondrial (EC 6.4.1.1)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0027580 CG1516 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q29RK2 PC "Pyruvate carboxylase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P11498 PC "Pyruvate carboxylase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:97520 Pcx "pyruvate carboxylase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3262 Pc "pyruvate carboxylase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q06862ACCC_NOSS16, ., 4, ., 1, ., 20.51920.46290.1118yesN/A
Q42523MCCA_ARATH6, ., 4, ., 1, ., 40.57690.46290.0681yesN/A
Q2QMG2MCCA_ORYSJ6, ., 4, ., 1, ., 40.55760.46290.0678yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
PRK12999 1146 PRK12999, PRK12999, pyruvate carboxylase; Reviewed 2e-19
TIGR01235 1143 TIGR01235, pyruv_carbox, pyruvate carboxylase 3e-18
COG1038 1149 COG1038, PycA, Pyruvate carboxylase [Energy produc 4e-18
COG4770 645 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase 3e-16
PRK06111 450 PRK06111, PRK06111, acetyl-CoA carboxylase biotin 6e-16
PRK08591 451 PRK08591, PRK08591, acetyl-CoA carboxylase biotin 1e-15
PRK05586 447 PRK05586, PRK05586, biotin carboxylase; Validated 6e-15
PRK07178 472 PRK07178, PRK07178, pyruvate carboxylase subunit A 3e-14
COG0439 449 COG0439, AccC, Biotin carboxylase [Lipid metabolis 3e-14
TIGR00514 449 TIGR00514, accC, acetyl-CoA carboxylase, biotin ca 3e-13
PRK08654 499 PRK08654, PRK08654, pyruvate carboxylase subunit A 3e-13
PRK08463 478 PRK08463, PRK08463, acetyl-CoA carboxylase subunit 4e-13
PRK08462 445 PRK08462, PRK08462, biotin carboxylase; Validated 3e-12
pfam02786211 pfam02786, CPSase_L_D2, Carbamoyl-phosphate syntha 4e-11
PRK12833 467 PRK12833, PRK12833, acetyl-CoA carboxylase biotin 3e-10
TIGR02712 1201 TIGR02712, urea_carbox, urea carboxylase 3e-09
>gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed Back     alignment and domain information 
 Score = 81.7 bits (203), Expect = 2e-19
 Identities = 26/40 (65%), Positives = 34/40 (85%)

Query: 55  FGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPI 94
           FG D++ +EK +  PRHIEVQILGDK+G+VVHLY+RDC +
Sbjct: 196 FGNDEVYLEKYVENPRHIEVQILGDKHGNVVHLYERDCSV 235

Length = 1146
>gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase Back     alignment and domain information
>gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|180406 PRK06111, PRK06111, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>gnl|CDD|236307 PRK08591, PRK08591, acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>gnl|CDD|180150 PRK05586, PRK05586, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|180865 PRK07178, PRK07178, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|223516 COG0439, AccC, Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|129605 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>gnl|CDD|236325 PRK08654, PRK08654, pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|169452 PRK08463, PRK08463, acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>gnl|CDD|236269 PRK08462, PRK08462, biotin carboxylase; Validated Back     alignment and domain information
>gnl|CDD|190425 pfam02786, CPSase_L_D2, Carbamoyl-phosphate synthase L chain, ATP binding domain Back     alignment and domain information
>gnl|CDD|183781 PRK12833, PRK12833, acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 108
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 100.0
KOG0238|consensus 670 100.0
COG1038 1149 PycA Pyruvate carboxylase [Energy production and c 100.0
COG0439 449 AccC Biotin carboxylase [Lipid metabolism] 99.97
KOG0369|consensus 1176 99.97
PF02786211 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, 99.97
KOG0368|consensus 2196 99.94
PRK08654 499 pyruvate carboxylase subunit A; Validated 99.93
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 99.89
PRK08463 478 acetyl-CoA carboxylase subunit A; Validated 99.89
PRK07178 472 pyruvate carboxylase subunit A; Validated 99.89
PRK12999 1146 pyruvate carboxylase; Reviewed 99.88
PRK12833 467 acetyl-CoA carboxylase biotin carboxylase subunit; 99.88
PRK05586 447 biotin carboxylase; Validated 99.85
PRK08462 445 biotin carboxylase; Validated 99.82
TIGR02712 1201 urea_carbox urea carboxylase. Members of this fami 99.82
TIGR00514 449 accC acetyl-CoA carboxylase, biotin carboxylase su 99.81
PRK08591 451 acetyl-CoA carboxylase biotin carboxylase subunit; 99.8
PRK06111 450 acetyl-CoA carboxylase biotin carboxylase subunit; 99.69
PF07478203 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In 99.56
PLN02735 1102 carbamoyl-phosphate synthase 99.5
PRK14570 364 D-alanyl-alanine synthetase A; Provisional 99.42
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 99.41
PLN02948 577 phosphoribosylaminoimidazole carboxylase 99.39
PLN02735 1102 carbamoyl-phosphate synthase 99.39
PRK01966333 ddl D-alanyl-alanine synthetase A; Reviewed 99.32
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 99.32
PRK14572347 D-alanyl-alanine synthetase A; Provisional 99.32
PRK14568343 vanB D-alanine--D-lactate ligase; Provisional 99.29
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 99.26
COG0458 400 CarB Carbamoylphosphate synthase large subunit (sp 99.25
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 99.24
PRK14569296 D-alanyl-alanine synthetase A; Provisional 99.23
PRK06524 493 biotin carboxylase-like protein; Validated 99.23
PRK14571299 D-alanyl-alanine synthetase A; Provisional 99.2
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 99.19
PRK14016 727 cyanophycin synthetase; Provisional 99.18
PLN02257 434 phosphoribosylamine--glycine ligase 99.17
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 99.15
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 99.14
TIGR01161 352 purK phosphoribosylaminoimidazole carboxylase, Pur 99.14
PF02222172 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 T 99.13
PRK13790 379 phosphoribosylamine--glycine ligase; Provisional 99.13
PRK13789 426 phosphoribosylamine--glycine ligase; Provisional 99.13
TIGR01142 380 purT phosphoribosylglycinamide formyltransferase 2 99.12
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 99.1
TIGR01205315 D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a 99.1
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 99.07
PRK00885 420 phosphoribosylamine--glycine ligase; Provisional 99.03
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 99.02
PF13535184 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 99.0
TIGR00877 423 purD phosphoribosylamine--glycine ligase. This enz 98.96
TIGR01435 737 glu_cys_lig_rel glutamate--cysteine ligase/gamma-g 98.93
PRK05784 486 phosphoribosylamine--glycine ligase; Provisional 98.91
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 98.91
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-gr 98.91
PRK10446300 ribosomal protein S6 modification protein; Provisi 98.88
), forming GARS-AIRS-GART. This entry represents the A-domain of the enzyme, and is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase.; PDB: 1GSO_A 3LP8_A 2IP4_A 1VKZ_A 2QK4_A 2XD4_A 2XCL_A 3MJF_A 2YRW_A 2YS6_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01071">PF01071194 GARS_A: Phosphoribosylglycinamide synthetase, ATP- 98.86
PRK12767326 carbamoyl phosphate synthase-like protein; Provisi 98.85
TIGR02068 864 cya_phycin_syn cyanophycin synthetase. Cyanophycin 98.82
PRK02471 752 bifunctional glutamate--cysteine ligase/glutathion 98.77
COG0151 428 PurD Phosphoribosylamine-glycine ligase [Nucleotid 98.76
PRK02186 887 argininosuccinate lyase; Provisional 98.75
KOG0370|consensus 1435 98.72
PRK07206 416 hypothetical protein; Provisional 98.69
PRK06395 435 phosphoribosylamine--glycine ligase; Provisional 98.65
KOG0370|consensus 1435 98.63
TIGR02144280 LysX_arch Lysine biosynthesis enzyme LysX. The fam 98.54
TIGR00768277 rimK_fam alpha-L-glutamate ligases, RimK family. T 98.54
COG0027 394 PurT Formate-dependent phosphoribosylglycinamide f 98.5
TIGR01016 386 sucCoAbeta succinyl-CoA synthetase, beta subunit. 98.48
PF08443190 RimK: RimK-like ATP-grasp domain; InterPro: IPR013 98.37
PRK13278 358 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D 98.32
PRK00696 388 sucC succinyl-CoA synthetase subunit beta; Provisi 98.27
COG0026 375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 98.08
PF13549222 ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A. 98.06
PRK13277 366 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 97.97
PF15632329 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa 97.95
PF08442202 ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 97.59
PRK06849 389 hypothetical protein; Provisional 97.52
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 mod 97.41
PLN02941328 inositol-tetrakisphosphate 1-kinase 97.24
COG0045 387 SucC Succinyl-CoA synthetase, beta subunit [Energy 97.24
PRK14046 392 malate--CoA ligase subunit beta; Provisional 97.23
PRK12458338 glutathione synthetase; Provisional 97.22
TIGR01380312 glut_syn glutathione synthetase, prokaryotic. This 97.03
PRK05246316 glutathione synthetase; Provisional 96.97
PF02655161 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 96.96
PLN02235 423 ATP citrate (pro-S)-lyase 96.93
PLN00124 422 succinyl-CoA ligase [GDP-forming] subunit beta; Pr 96.86
COG3919 415 Predicted ATP-grasp enzyme [General function predi 96.35
COG1759 361 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofu 96.26
KOG0237|consensus 788 96.03
PF11379 355 DUF3182: Protein of unknown function (DUF3182); In 95.98
PF02750203 Synapsin_C: Synapsin, ATP binding domain; InterPro 95.13
COG2232 389 Predicted ATP-dependent carboligase related to bio 94.59
TIGR02291 317 rimK_rel_E_lig alpha-L-glutamate ligase-related pr 93.87
PF02955173 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP 93.0
PF03133 292 TTL: Tubulin-tyrosine ligase family; InterPro: IPR 90.98
PF14397 285 ATPgrasp_ST: Sugar-transfer associated ATP-grasp 90.95
PF05770307 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6- 82.06
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-40  Score=266.51  Aligned_cols=105  Identities=28%  Similarity=0.452  Sum_probs=101.7

Q ss_pred             ccccHHHHHHHhhhcC-CeEEEcCCCc--eeeEEeCCHHHHHHHHHHHhhhHhhhcCCCcEEEeecCCCCeEEEEEEEec
Q psy11786          3 KNKAFSRLMIFNSIHG-PICQRLVAEV--VACEWLLTKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGD   79 (108)
Q Consensus         3 ~~~~~~~~~~~~~~~g-Pv~vKp~~gG--~G~~iV~~~~el~~a~~~a~~~a~~~fgd~~vlIE~~i~~~reievqvl~d   79 (108)
                      ..++.+++..+|++|| ||+||+++||  +||++|++.+++.++|++++++|+++|||+++|||||+..|||||+|||+|
T Consensus       137 ~~qd~~~~~~~A~eiGyPVlIKAsaGGGGKGMRvv~~~~e~~e~l~sarrEA~asFGddrv~iEkyl~~PRHIEiQV~aD  216 (645)
T COG4770         137 PIQDAAELVAIAEEIGYPVLIKASAGGGGKGMRVVETPEEFAEALESARREAKASFGDDRVFIEKYLDKPRHIEIQVFAD  216 (645)
T ss_pred             cccCHHHHHHHHHhcCCcEEEEeccCCCCCceEeecCHHHHHHHHHHHHHHHHhhcCCceEehhhhcCCCceEEEEEEec
Confidence            3578899999999999 9999999887  999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCEEEecccccccccCce--eccCCCCC
Q psy11786         80 KYGDVVHLYDRDCPIYAEKI--SESHPKSL  107 (108)
Q Consensus        80 ~~g~~~~l~eR~Csiq~r~q--~e~~p~~~  107 (108)
                      +|||++||+|||||||||||  |||||+++
T Consensus       217 ~HGNvv~LgERdCSlQRRhQKVIEEAPaP~  246 (645)
T COG4770         217 QHGNVVHLGERDCSLQRRHQKVIEEAPAPF  246 (645)
T ss_pred             CCCCEEEeeccccchhhhcchhhhcCCCCC
Confidence            99999999999999999999  99999986

>KOG0238|consensus Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>KOG0369|consensus Back     alignment and domain information
>PF02786 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, ATP binding domain; InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>PRK07178 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6 Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PRK14570 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK14572 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK14568 vanB D-alanine--D-lactate ligase; Provisional Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK14569 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>PRK14571 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK14016 cyanophycin synthetase; Provisional Back     alignment and domain information
>PLN02257 phosphoribosylamine--glycine ligase Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>PF02222 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 The ATP-grasp domain has an unusual nucleotide-binding fold, also referred to as palmate, and is found in a superfamily of enzymes including D-alanine-D-alanine ligase, glutathione synthetase, biotin carboxylase, and carbamoyl phosphate synthetase, the ribosomal protein S6 modification enzyme (RimK), urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PF13535 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 3LN7_B 2PN1_A 4DIM_A Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>PF01071 GARS_A: Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain; InterPro: IPR020561 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>KOG0370|consensus Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>KOG0370|consensus Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit Back     alignment and domain information
>PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [] Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13549 ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon Back     alignment and domain information
>PF08442 ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 The ATP-grasp superfamily currently includes 17 groups of enzymes, catalyzing ATP-dependent ligation of a carboxylate containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02941 inositol-tetrakisphosphate 1-kinase Back     alignment and domain information
>COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK14046 malate--CoA ligase subunit beta; Provisional Back     alignment and domain information
>PRK12458 glutathione synthetase; Provisional Back     alignment and domain information
>TIGR01380 glut_syn glutathione synthetase, prokaryotic Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>PF02655 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>PLN02235 ATP citrate (pro-S)-lyase Back     alignment and domain information
>PLN00124 succinyl-CoA ligase [GDP-forming] subunit beta; Provisional Back     alignment and domain information
>COG3919 Predicted ATP-grasp enzyme [General function prediction only] Back     alignment and domain information
>COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0237|consensus Back     alignment and domain information
>PF11379 DUF3182: Protein of unknown function (DUF3182); InterPro: IPR021519 This family of proteins with unknown function appears to be restricted to Proteobacteria Back     alignment and domain information
>PF02750 Synapsin_C: Synapsin, ATP binding domain; InterPro: IPR020898 The synapsins are a family of neuron-specific phosphoproteins that coat synaptic vesicles and are involved in the binding between these vesicles and the cytoskeleton (including actin filaments) Back     alignment and domain information
>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein Back     alignment and domain information
>PF02955 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP-grasp domain; InterPro: IPR004218 Prokaryotic glutathione synthetase 6 Back     alignment and domain information
>PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed Back     alignment and domain information
>PF14397 ATPgrasp_ST: Sugar-transfer associated ATP-grasp Back     alignment and domain information
>PF05770 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6-kinase; InterPro: IPR008656 This entry represents inositol-tetrakisphosphate 1-kinase which is also called inositol 1,3,4-trisphosphate 5/6-kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
2dzd_A 461 Crystal Structure Of The Biotin Carboxylase Domain 3e-12
1ulz_A 451 Crystal Structure Of The Biotin Carboxylase Subunit 1e-10
3tw7_A 1165 Structure Of Rhizobium Etli Pyruvate Carboxylase T8 2e-10
2qf7_A 1165 Crystal Structure Of A Complete Multifunctional Pyr 2e-10
3hbl_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 4e-10
3ho8_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 4e-10
4hnt_A 1173 Crystal Structure Of F403a Mutant Of S. Aureus Pyru 4e-10
3hb9_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 4e-10
3bg5_A 1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 4e-10
4hnv_A 1173 Crystal Structure Of R54e Mutant Of S. Aureus Pyruv 4e-10
4hnu_A 1173 Crystal Structure Of K442e Mutant Of S. Aureus Pyru 4e-10
2vpq_A 451 Crystal Structure Of Biotin Carboxylase From S. Aur 2e-08
3u9s_A 655 Crystal Structure Of P. Aeruginosa 3-methylcrotonyl 2e-07
3ouz_A 446 Crystal Structure Of Biotin Carboxylase-Adp Complex 3e-07
3n6r_A 681 Crystal Structure Of The Holoenzyme Of Propionyl-co 4e-07
2vqd_A 464 Crystal Structure Of Biotin Carboxylase From Pseudo 9e-07
2hjw_A 573 Crystal Structure Of The Bc Domain Of Acc2 Length = 3e-05
3gid_A 540 The Biotin Carboxylase (Bc) Domain Of Human Acetyl- 3e-05
3jrw_A 587 Phosphorylated Bc Domain Of Acc2 Length = 587 3e-05
3jrx_A 587 Crystal Structure Of The Bc Domain Of Acc2 In Compl 3e-05
3va7_A 1236 Crystal Structure Of The Kluyveromyces Lactis Urea 3e-05
3g8c_A 444 Crystal Stucture Of Biotin Carboxylase In Complex W 4e-05
1bnc_A 449 Three-Dimensional Structure Of The Biotin Carboxyla 4e-05
3jzf_A 486 Crystal Structure Of Biotin Carboxylase From E. Col 4e-05
3g8d_A 444 Crystal Structure Of The Biotin Carboxylase Subunit 4e-05
2gpw_A 469 Crystal Structure Of The Biotin Carboxylase Subunit 4e-05
1dv2_A 452 The Structure Of Biotin Carboxylase, Mutant E288k, 4e-05
3rv4_A 452 Crystal Structure Of E.Coli Biotin Carboxylase R16e 4e-05
3rup_B 452 Crystal Structure Of E.Coli Biotin Carboxylase In C 4e-05
2gps_A 469 Crystal Structure Of The Biotin Carboxylase Subunit 4e-05
1w93_A 553 Crystal Structure Of Biotin Carboxylase Domain Of A 4e-05
1w96_A 554 Crystal Structure Of Biotin Carboxylase Domain Of A 4e-05
2yl2_A 540 Crystal Structure Of Human Acetyl-Coa Carboxylase 1 8e-05
>pdb|2DZD|A Chain A, Crystal Structure Of The Biotin Carboxylase Domain Of Pyruvate Carboxylase Length = 461 Back     alignment and structure 
Iteration: 1

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 47/72 (65%), Gaps = 2/72 (2%)
Query: 36  TKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPIY 95
           +K  ++E F+RA  +    FG D++ VEK I  P+HIEVQILGD  G++VHLY+RDC + 
Sbjct: 178 SKSEVKEAFERAKSEAKAAFGSDEVYVEKLIENPKHIEVQILGDYEGNIVHLYERDCSVQ 237
Query: 96  A--EKISESHPK 105
              +K+ E  P 
Sbjct: 238 RRHQKVVEVAPS 249
>pdb|1ULZ|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit Of Pyruvate Carboxylase Length = 451 Back     alignment and structure
>pdb|3TW7|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a Crystallized Without Acetyl Coenzyme-A Length = 1165 Back     alignment and structure
>pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 Back     alignment and structure
>pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 Back     alignment and structure
>pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 Back     alignment and structure
>pdb|4HNT|A Chain A, Crystal Structure Of F403a Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 Back     alignment and structure
>pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNV|A Chain A, Crystal Structure Of R54e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|4HNU|A Chain A, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
>pdb|2VPQ|A Chain A, Crystal Structure Of Biotin Carboxylase From S. Aureus Complexed With Amppnp Length = 451 Back     alignment and structure
>pdb|3U9S|A Chain A, Crystal Structure Of P. Aeruginosa 3-methylcrotonyl-coa Carboxylase (mcc) 750 Kd Holoenzyme, Coa Complex Length = 655 Back     alignment and structure
>pdb|3OUZ|A Chain A, Crystal Structure Of Biotin Carboxylase-Adp Complex From Campylobacter Jejuni Length = 446 Back     alignment and structure
>pdb|3N6R|A Chain A, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 681 Back     alignment and structure
>pdb|2VQD|A Chain A, Crystal Structure Of Biotin Carboxylase From Pseudomonas Aeruginosa Complexed With Ampcp Length = 464 Back     alignment and structure
>pdb|2HJW|A Chain A, Crystal Structure Of The Bc Domain Of Acc2 Length = 573 Back     alignment and structure
>pdb|3GID|A Chain A, The Biotin Carboxylase (Bc) Domain Of Human Acetyl-Coa Carboxylase 2 (Acc2) In Complex With Soraphen A Length = 540 Back     alignment and structure
>pdb|3JRW|A Chain A, Phosphorylated Bc Domain Of Acc2 Length = 587 Back     alignment and structure
>pdb|3JRX|A Chain A, Crystal Structure Of The Bc Domain Of Acc2 In Complex With Soraphen A Length = 587 Back     alignment and structure
>pdb|3VA7|A Chain A, Crystal Structure Of The Kluyveromyces Lactis Urea Carboxylase Length = 1236 Back     alignment and structure
>pdb|3G8C|A Chain A, Crystal Stucture Of Biotin Carboxylase In Complex With Biotin, Bicarbonate, Adp And Mg Ion Length = 444 Back     alignment and structure
>pdb|1BNC|A Chain A, Three-Dimensional Structure Of The Biotin Carboxylase Subunit Of Acetyl-Coa Carboxylase Length = 449 Back     alignment and structure
>pdb|3JZF|A Chain A, Crystal Structure Of Biotin Carboxylase From E. Coli In Complex With Benzimidazoles Series Length = 486 Back     alignment and structure
>pdb|3G8D|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E296a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli Length = 444 Back     alignment and structure
>pdb|2GPW|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, F363a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 Back     alignment and structure
>pdb|1DV2|A Chain A, The Structure Of Biotin Carboxylase, Mutant E288k, Complexed With Atp Length = 452 Back     alignment and structure
>pdb|2GPS|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E23r Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 Back     alignment and structure
>pdb|1W93|A Chain A, Crystal Structure Of Biotin Carboxylase Domain Of Acetyl- Coenzyme A Carboxylase From Saccharomyces Cerevisiae Length = 553 Back     alignment and structure
>pdb|1W96|A Chain A, Crystal Structure Of Biotin Carboxylase Domain Of Acetyl- Coenzyme A Carboxylase From Saccharomyces Cerevisiae In Complex With Soraphen A Length = 554 Back     alignment and structure
>pdb|2YL2|A Chain A, Crystal Structure Of Human Acetyl-Coa Carboxylase 1, Biotin Carboxylase (Bc) Domain Length = 540 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 7e-21
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 8e-21
2dzd_A 461 Pyruvate carboxylase; biotin carboxylase, ligase; 9e-21
1ulz_A 451 Pyruvate carboxylase N-terminal domain; biotin car 4e-19
2vpq_A 451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 6e-19
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein 9e-19
1w96_A 554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 2e-18
3ouz_A 446 Biotin carboxylase; structural genomics, center fo 2e-18
3u9t_A 675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 2e-18
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 6e-18
2w70_A 449 Biotin carboxylase; ligase, ATP-binding, fatty aci 8e-18
3jrx_A 587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 1e-17
3glk_A 540 Acetyl-COA carboxylase 2; ATP binding, alternative 2e-17
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondri 2e-07
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 Back     alignment and structure
 Score = 85.1 bits (211), Expect = 7e-21
 Identities = 24/59 (40%), Positives = 39/59 (66%)

Query: 36  TKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPI 94
           ++  + +    A  +    FGKD++ +EK + R RH+E QILGD +G+VVHL++RDC +
Sbjct: 192 SEADLAKEVTEAKREAMAAFGKDEVYLEKLVERARHVESQILGDTHGNVVHLFERDCSV 250
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Length = 461 Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Length = 451 Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Length = 451 Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Length = 554 Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Length = 446 Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Length = 449 Back     alignment and structure
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Length = 587 Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Length = 540 Back     alignment and structure
>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 108 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
3jrx_A 587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 99.88
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein 99.87
3u9t_A 675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 99.87
3glk_A 540 Acetyl-COA carboxylase 2; ATP binding, alternative 99.86
3ouz_A 446 Biotin carboxylase; structural genomics, center fo 99.85
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 99.81
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 99.8
2vpq_A 451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 99.78
2dzd_A 461 Pyruvate carboxylase; biotin carboxylase, ligase; 99.77
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 99.77
1ulz_A 451 Pyruvate carboxylase N-terminal domain; biotin car 99.77
1w96_A 554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 99.77
2w70_A 449 Biotin carboxylase; ligase, ATP-binding, fatty aci 99.75
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondri 99.55
3vmm_A 474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 99.55
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 99.5
1wr2_A238 Hypothetical protein PH1789; structural genomics, 99.48
4fu0_A357 D-alanine--D-alanine ligase 7; vancomycin resistan 99.45
3e5n_A 386 D-alanine-D-alanine ligase A; bacterial blight; 2. 99.39
1ehi_A 377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 99.39
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 99.39
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 99.38
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 99.37
3aw8_A 369 PURK, phosphoribosylaminoimidazole carboxylase, AT 99.36
1vkz_A 412 Phosphoribosylamine--glycine ligase; TM1250, struc 99.34
3tqt_A 372 D-alanine--D-alanine ligase; cell envelope; 1.88A 99.34
4eg0_A317 D-alanine--D-alanine ligase; structural genomics, 99.33
3lwb_A373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 99.33
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 99.32
2i87_A 364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 99.32
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 99.3
2yw2_A 424 Phosphoribosylamine--glycine ligase; glycinamide r 99.28
3eth_A 355 Phosphoribosylaminoimidazole carboxylase ATPase su 99.28
3vot_A 425 L-amino acid ligase, BL00235; ATP-grAsp motif, ATP 99.27
3se7_A346 VANA; alpha-beta structure, D-alanine-D-lactate li 99.24
3mjf_A 431 Phosphoribosylamine--glycine ligase; structural ge 99.24
2ip4_A 417 PURD, phosphoribosylamine--glycine ligase; GAR syn 99.22
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 99.2
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 99.2
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 99.17
4dim_A 403 Phosphoribosylglycinamide synthetase; structural g 99.17
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein; 99.16
2z04_A 365 Phosphoribosylaminoimidazole carboxylase ATPase su 99.15
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 99.14
2xcl_A 422 Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- 99.13
3lp8_A 442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, n 99.13
2yrx_A 451 Phosphoribosylglycinamide synthetase; glycinamide 99.12
2qk4_A 452 Trifunctional purine biosynthetic protein adenosi; 99.12
3ln7_A 757 Glutathione biosynthesis bifunctional protein GSH; 99.1
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 99.08
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 99.07
3r5x_A307 D-alanine--D-alanine ligase; alpha-beta structure, 99.06
2dwc_A 433 PH0318, 433AA long hypothetical phosphoribosylglyc 99.06
3ln6_A 750 Glutathione biosynthesis bifunctional protein GSH; 98.99
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 98.98
3ufx_B 397 Succinyl-COA synthetase beta subunit; ATP-grAsp fo 98.95
2pn1_A331 Carbamoylphosphate synthase large subunit; ZP_0053 98.94
2nu8_B 388 SCS-beta, succinyl-COA synthetase beta chain; citr 98.9
3ax6_A 380 Phosphoribosylaminoimidazole carboxylase, ATPase; 98.82
2fp4_B 395 Succinyl-COA ligase [GDP-forming] beta-chain, mito 98.81
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 98.75
1gsa_A316 Glutathione synthetase; ligase; HET: ADP GSH; 2.00 98.65
2r85_A 334 PURP protein PF1517; ATP-grAsp superfamily, unknow 98.55
3df7_A305 Putative ATP-grAsp superfamily protein; putative p 98.12
1i7n_A309 Synapsin II; synapse, phosphorylation, neuropeptid 98.11
1z2n_X 324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol 98.09
2r7k_A 361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib 98.04
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release 97.98
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 97.96
2q7d_A 346 Inositol-tetrakisphosphate 1-kinase; inositol kina 97.84
2pbz_A 320 Hypothetical protein; NYSGXRC, PSI-II, IMP biosynt 97.79
3mwd_A 425 ATP-citrate synthase; ATP-grAsp, phosphohistidine, 97.26
3pff_A 829 ATP-citrate synthase; phosphohistidine, organic ac 96.87
3tig_A 380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 94.19
3t7a_A330 Inositol pyrophosphate kinase; ATP-grAsp fold, tra 89.05
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Back     alignment and structure
Probab=99.88  E-value=1.6e-22  Score=165.21  Aligned_cols=98  Identities=23%  Similarity=0.351  Sum_probs=90.8

Q ss_pred             ccHHHHHHHhhhcC-CeEEEcCCCc--eeeEEeCCHHHHHHHHHHHhhhHhhhcCCCcEEEeecCCCCeEEEEEEEecCC
Q psy11786          5 KAFSRLMIFNSIHG-PICQRLVAEV--VACEWLLTKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKY   81 (108)
Q Consensus         5 ~~~~~~~~~~~~~g-Pv~vKp~~gG--~G~~iV~~~~el~~a~~~a~~~a~~~fgd~~vlIE~~i~~~reievqvl~d~~   81 (108)
                      .+.+++.++++++| ||||||+.||  +||++|++.++|..+++.+.+++.    ++.+|||+||++++|++|++++|++
T Consensus       231 ~s~eea~~~a~~iGyPvVVKp~~GgGGkGv~iV~s~eEL~~a~~~a~~~~~----~~~vlVEeyI~g~rei~V~vl~D~~  306 (587)
T 3jrx_A          231 KDVDEGLEAAERIGFPLMIKASEGGGGKGIRKAESAEDFPILFRQVQSEIP----GSPIFLMKLAQHARHLEVQILADQY  306 (587)
T ss_dssp             CSHHHHHHHHHHHCSSEEEEETTCCSSSSEEEECSTTTHHHHHHHHHHHST----TCCEEEEECCCSCEEEEEEEEECSS
T ss_pred             CCHHHHHHHHHhcCCeEEEEeCCCCCCCCeEEeCCHHHHHHHHHHHHhhcc----CCCEEEEEecCCCcEEEEEEEEcCC
Confidence            46788888999999 9999998666  999999999999999999988754    6789999999999999999999999


Q ss_pred             CCEEEecccccccccCce--eccCCCC
Q psy11786         82 GDVVHLYDRDCPIYAEKI--SESHPKS  106 (108)
Q Consensus        82 g~~~~l~eR~Csiq~r~q--~e~~p~~  106 (108)
                      |+++++++|+||+|+|+|  +|++|+.
T Consensus       307 G~vv~l~~rd~siqrr~qk~ie~aPa~  333 (587)
T 3jrx_A          307 GNAVSLFGRDCSIQRRHQKIVEEAPAT  333 (587)
T ss_dssp             SCEEEEEEEEEEEESSSCEEEEEESCC
T ss_pred             CCEEEEeeeeccccccccceeEecCCC
Confidence            999999999999999999  9999987
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Back     alignment and structure
>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>1wr2_A Hypothetical protein PH1789; structural genomics, NPPSFA, national on protein structural and functional analyses; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Back     alignment and structure
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Back     alignment and structure
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A Back     alignment and structure
>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* Back     alignment and structure
>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A Back     alignment and structure
>2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Back     alignment and structure
>3ufx_B Succinyl-COA synthetase beta subunit; ATP-grAsp fold, ligase; HET: GDP; 2.35A {Thermus aquaticus} Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>2nu8_B SCS-beta, succinyl-COA synthetase beta chain; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.23.4.1 d.142.1.4 PDB: 1scu_B* 2nu6_B* 1jkj_B* 2nu7_B* 2nu9_B* 2nua_B* 2scu_B* 1jll_B* 1cqj_B* 1cqi_B* Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>2fp4_B Succinyl-COA ligase [GDP-forming] beta-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.23.4.1 d.142.1.4 PDB: 2fpg_B* 2fpi_B* 2fpp_B* 1euc_B* 1eud_B* Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Back     alignment and structure
>1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Back     alignment and structure
>1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* Back     alignment and structure
>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Back     alignment and structure
>2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X Back     alignment and structure
>2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP structural genomics, protein structure initiative; HET: ATP; 2.50A {Thermococcus kodakarensis} SCOP: c.30.1.8 d.142.1.9 Back     alignment and structure
>3mwd_A ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_A* Back     alignment and structure
>3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Back     alignment and structure
>3t7a_A Inositol pyrophosphate kinase; ATP-grAsp fold, transferase; HET: ADP; 1.70A {Homo sapiens} PDB: 3t9a_A* 3t9b_A* 3t9c_A* 3t9d_A* 3t9e_A* 3t9f_A* 4gb4_A* 4hn2_A* 3t54_A* 3t99_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 108
d1ulza3214 d.142.1.2 (A:115-328) Biotin carboxylase (BC), dom 5e-06
d1a9xa6 259 d.142.1.2 (A:677-935) Carbamoyl phosphate syntheta 5e-05
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Length = 214 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: BC ATP-binding domain-like
domain: Biotin carboxylase (BC), domain 2
species: Aquifex aeolicus [TaxId: 63363]

 Score = 41.0 bits (95), Expect = 5e-06
 Identities = 24/40 (60%), Positives = 33/40 (82%)

Query: 55  FGKDDMLVEKDIGRPRHIEVQILGDKYGDVVHLYDRDCPI 94
           FG+ D+L+EK I  P+HIE Q+LGDK+G+V+HL +RDC I
Sbjct: 77  FGRGDLLLEKFIENPKHIEYQVLGDKHGNVIHLGERDCSI 116
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
d1a9xa5 275 Carbamoyl phosphate synthetase (CPS), large subuni 99.89
d2j9ga3216 Biotin carboxylase (BC), domain 2 {Escherichia col 99.87
d1a9xa6 259 Carbamoyl phosphate synthetase (CPS), large subuni 99.75
d1w96a3 267 Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye 99.74
d1ulza3214 Biotin carboxylase (BC), domain 2 {Aquifex aeolicu 99.72
d1vkza3220 Glycinamide ribonucleotide synthetase (GAR-syn), d 99.46
d1gsoa3224 Glycinamide ribonucleotide synthetase (GAR-syn), d 99.37
d1iowa2210 D-ala-D-ala ligase, C-domain {Escherichia coli, ge 99.33
d1ehia2 228 D-alanine:D-lactate ligase VanA, C-domain {Leucono 99.28
d1kjqa3206 Glycinamide ribonucleotide transformylase PurT, do 99.21
d1e4ea2211 D-alanine:D-lactate ligase VanA, C-domain {Enteroc 99.18
d2r7ka2 238 5-formaminoimidazole-4-carboxamide ribonucleotide 99.16
d1i7na2206 Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116 99.15
d2r85a2 235 5-formaminoimidazole-4-carboxamide ribonucleotide 98.84
d3etja3198 N5-carboxyaminoimidazole ribonucleotide synthetase 98.7
d1uc8a2192 Lysine biosynthesis enzyme LysX ATP-binding domain 98.65
d2nu7b2238 Succinyl-CoA synthetase, beta-chain, N-terminal do 97.67
d1eucb2246 Succinyl-CoA synthetase, beta-chain, N-terminal do 97.05
d1gsaa2192 Prokaryotic glutathione synthetase, C-domain {Esch 96.96
d2pbza2 213 5-formaminoimidazole-4-carboxamide ribonucleotide 82.79
>d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: BC ATP-binding domain-like
domain: Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains
species: Escherichia coli [TaxId: 562]

Probab=99.89  E-value=6.3e-23  Score=151.48  Aligned_cols=98  Identities=12%  Similarity=0.110  Sum_probs=88.0

Q ss_pred             ccHHHHHHHhhhcC-CeEEEcCCCc--eeeEEeCCHHHHHHHHHHHhhhHhhhcCCCcEEEeecCCCCeEEEEEEEecCC
Q psy11786          5 KAFSRLMIFNSIHG-PICQRLVAEV--VACEWLLTKDAIEENFKRAGPKLWLFFGKDDMLVEKDIGRPRHIEVQILGDKY   81 (108)
Q Consensus         5 ~~~~~~~~~~~~~g-Pv~vKp~~gG--~G~~iV~~~~el~~a~~~a~~~a~~~fgd~~vlIE~~i~~~reievqvl~d~~   81 (108)
                      ++.+++.++++++| |++|||+.||  +||++|++.++|..+++.+...    +++.+++||+|+++++|+++++++|++
T Consensus        23 ~~~~ea~~~~~~ig~PvviKp~~~~gg~G~~~v~~~~el~~~~~~a~~~----~~~~~v~iEe~l~g~~e~~v~~~~d~~   98 (275)
T d1a9xa5          23 HTMEEALAVAADVGFPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDL----SPTKELLIDESLIGWKEYEMEVVRDKN   98 (275)
T ss_dssp             SSHHHHHHHHHHHCSSEEEEETTCCTTTTCEEESSHHHHHHHHHHHHHH----CTTSCEEEEECCTTSEEEEEEEEECTT
T ss_pred             CCHHHHHHHHHHcCCCEEEEECCCCCCCceEEeeCHHHHHHHHHHHHhh----CCCCcEEEeeecCCchhheeeeEEecC
Confidence            57899999999999 9999997544  9999999999999988887665    568899999999999999999999998


Q ss_pred             CCE--EEecccccccccCce--eccCCCC
Q psy11786         82 GDV--VHLYDRDCPIYAEKI--SESHPKS  106 (108)
Q Consensus        82 g~~--~~l~eR~Csiq~r~q--~e~~p~~  106 (108)
                      |+.  .++.+|+|++|+|+|  +|+||++
T Consensus        99 g~~~~~~~~~~~~~~~~~~~~~~~~aP~~  127 (275)
T d1a9xa5          99 DNCIIVCSIENFDAMGIHTGDSITVAPAQ  127 (275)
T ss_dssp             CCEEEEEEEEESSCTTSCGGGSCEEESCC
T ss_pred             CCEEEEEeeccccccCcccCceeEEcCCC
Confidence            884  467899999999999  9999986
>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2nu7b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eucb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gsaa2 d.142.1.1 (A:123-314) Prokaryotic glutathione synthetase, C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pbza2 d.142.1.9 (A:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure