Diaphorina citri psyllid: psy11787


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MYLQLFLKLCLNSYCGLDHKLNSPENGTVSKLLDSSNVPCPIVYGAVVDSACLVWESVCGEKGACNLYDTDVFRVFYHEKCVLSIELELYWTPVVITRVQ
cHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHcccccHccccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MYLQLFLKLCLNSYCGLDHKLNSPENGTVSKLLDSSNVPCPIVYGAVVDSACLVWESVCGEKGACNLYDTDVFRVFYHEKCVLSIELELYWTPVVITRVQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLQLFLKLCLNSYCGLDHKLNSPENGTVSKLLDSSNVPCPIVYGAVVDSACLVWESVCGEKGACNLYDTDVFRVFYHEKCVLSIELELYWTPVVITRVQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0015721 [BP]bile acid and bile salt transportprobableGO:0015718, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0044765, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0015125 [MF]bile acid transmembrane transporter activityprobableGO:0005319, GO:0022891, GO:0022892, GO:0005342, GO:0008028, GO:0005215, GO:0008509, GO:0015075, GO:0008514, GO:0022857, GO:0003674, GO:0046943
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PW4, chain A
Confidence level:probable
Coverage over the Query: 12-50
View the alignment between query and template
View the model in PyMOL