Mediates the Na(+)-independent transport of organic anions such as estrone-3-sulfate (PubMed:10873595). Mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin, but not DPDPE (a derivative of enkephalin lacking an N-terminal tyrosine residue), estrone-3-sulfate, taurocholate, digoxin nor DHEAS (PubMed:16971491). Homo sapiens (taxid: 9606)
>sp|Q99N02|SO3A1_RAT Solute carrier organic anion transporter family member 3A1 OS=Rattus norvegicus GN=Slco3a1 PE=2 SV=1
Mediates the Na(+)-independent transport of organic anions (By similarity). Mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin.
Rattus norvegicus (taxid: 10116)
>sp|Q8HYW2|SO3A1_BOVIN Solute carrier organic anion transporter family member 3A1 OS=Bos taurus GN=SLCO3A1 PE=2 SV=1
Mediates the Na(+)-independent transport of organic anions (By similarity). Mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin.
Bos taurus (taxid: 9913)
>sp|Q8R3L5|SO3A1_MOUSE Solute carrier organic anion transporter family member 3A1 OS=Mus musculus GN=Slco3a1 PE=2 SV=1
Mediates the Na(+)-independent transport of organic anions (By similarity). Mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin.
Mus musculus (taxid: 10090)
>sp|P46721|SO1A2_HUMAN Solute carrier organic anion transporter family member 1A2 OS=Homo sapiens GN=SLCO1A2 PE=2 SV=1
Mediates the Na(+)-independent transport of organic anions such as sulfobromophthalein (BSP) and conjugated (taurocholate) and unconjugated (cholate) bile acids (By similarity). Selectively inhibited by the grapefruit juice component naringin.
Homo sapiens (taxid: 9606)
>sp|O35913|SO1A4_RAT Solute carrier organic anion transporter family member 1A4 OS=Rattus norvegicus GN=Slco1a4 PE=2 SV=1
Mediates the Na(+)-independent transport of organic anions such as taurocholate, cholate, 17-beta-glucuronosyl estradiol, estrone-3-sulfate, the cardiac glycosides ouabain and digoxin and thyroid hormones. May play an especially important role in the brain accumulation and toxicity of digoxin and in the hepatobiliary and renal excretion of cardiac glycosides.
Rattus norvegicus (taxid: 10116)
>sp|Q9EP96|SO1A4_MOUSE Solute carrier organic anion transporter family member 1A4 OS=Mus musculus GN=Slco1a4 PE=2 SV=1
Mediates the Na(+)-independent transport of organic anions such as taurocholate, cholate, 17-beta-glucuronosyl estradiol, estrone-3-sulfate, the cardiac glycosides ouabain and digoxin and thyroid hormones.
Mus musculus (taxid: 10090)
>sp|Q9GMU6|SO1C1_MACFA Solute carrier organic anion transporter family member 1C1 OS=Macaca fascicularis GN=SLCO1C1 PE=2 SV=1
Mediates the Na(+)-independent high affinity transport of organic anions such as the thyroid hormones thyroxine (T4) and rT3. Other potential substrates, such as triiodothyronine (T3), estradiol-17-beta-glucuronide, estrone-3-sulfate and sulfobromophthalein (BSP) are transported with much lower efficiency. May play a signifiant role in regulating T4 flux into and out of the brain.
Macaca fascicularis (taxid: 9541)
>sp|Q9NYB5|SO1C1_HUMAN Solute carrier organic anion transporter family member 1C1 OS=Homo sapiens GN=SLCO1C1 PE=2 SV=1
Mediates the Na(+)-independent high affinity transport of organic anions such as the thyroid hormones thyroxine (T4) and rT3. Other potential substrates, such as triiodothyronine (T3), 17-beta-glucuronosyl estradiol, estrone-3-sulfate and sulfobromophthalein (BSP) are transported with much lower efficiency. May play a signifiant role in regulating T4 flux into and out of the brain.
Homo sapiens (taxid: 9606)
>sp|P46720|SO1A1_RAT Solute carrier organic anion transporter family member 1A1 OS=Rattus norvegicus GN=Slco1a1 PE=1 SV=1
Mediates the Na(+)-independent transport of organic anions such as bromosulfobromophthalein (BSP) and conjugated (taurocholate) and unconjugated (cholate) bile acids.
Rattus norvegicus (taxid: 10116)
Close Homologs in the Non-Redundant Database Detected by BLAST
Score = 60.4 bits (147), Expect = 3e-12
Identities = 20/39 (51%), Positives = 28/39 (71%), Gaps = 1/39 (2%)
Query: 37 NVPCPIVYGAVVDSACLVWESVC-GEKGACNLYDTDVFR 74
+P PI++GA++DS CL W + C G++GAC LYD D R
Sbjct: 544 FIPAPIIFGALIDSTCLKWGTSCCGKRGACRLYDNDSLR 582
This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters. Length = 582
Score = 54.0 bits (130), Expect = 7e-10
Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
Query: 38 VPCPIVYGAVVDSACLVWESVC-GEKGACNLYDTDVFRVFYH 78
+P PI++G ++D +CL W+++C G +GAC +YD D R Y
Sbjct: 569 IPAPILFGLLIDVSCLHWQTLCCGARGACRMYDNDNLRNIYL 610
The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange. Length = 633
Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange.
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs)
Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules) so a scheme of using digits for rat OATPs and letters for human ones was introduced []. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the UniProtKB/Swiss-Prot database) as belonging to the SLC21 family of transporters.; GO: 0005215 transporter activity, 0006810 transport, 0016020 membrane; PDB: 3MRR_P.
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon
This protein is a part of the Major Facilitator Superfamily (Pfam family pfam07690). Member of this family are found in a number of proteobacterial genomes, but only in the context of having genes for 4-hydroxyphenylacetate (4-HPA) degradation. The protein is characterized by Prieto, et al. (PubMed:9315705) as 4-hydroxyphenylacetate permease in E. coli, where 3-HPA and 3,4-dihydroxyphenylacetate are shown to competitively inhibit 4-HPA transport and therefore also interact specificially.
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters
MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3
This model represents the metabolite:H+ symport subfamily of the major facilitator superfamily (pfam00083), including citrate-H+ symporters, dicarboxylate:H+ symporters, the proline/glycine-betaine transporter ProP, etc.
This family of proteins includes the ribitol and D-arabinitol transporters from Klebsiella pneumoniae and the alpha-ketoglutarate permease from Bacillus subtilis.
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily
This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli.
