Diaphorina citri psyllid: psy11791


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MELQDVTLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEVYKKLSNGNRNNVENINPTMEKTRSYSEGNDKGGFVSVKDRAISIDNNSSIKQKPKVAKRTIFPVIPSYENIPTDNEVTKLY
cccccEEEEEEEcccccccccccEEcccccEEEEEEcccccccEEEcccccCEEEccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
****DVTLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEVYKKL******************************************************RTIFPVIPSY***********L*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELQDVTLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEVYKKLSNGNRNNVENINPTMEKTRSYSEGNDKGGFVSVKDRAISIDNNSSIKQKPKVAKRTIFPVIPSYENIPTDNEVTKLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Rho GTPase-activating protein 12 GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.confidentQ8IWW6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044422 [CC]organelle partprobableGO:0005575, GO:0043226
GO:0019219 [BP]regulation of nucleobase-containing compound metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005856 [CC]cytoskeletonprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QWY, chain A
Confidence level:very confident
Coverage over the Query: 5-63
View the alignment between query and template
View the model in PyMOL
Template: 1FMK, chain A
Confidence level:very confident
Coverage over the Query: 6-97
View the alignment between query and template
View the model in PyMOL
Template: 1K9A, chain A
Confidence level:confident
Coverage over the Query: 4-132
View the alignment between query and template
View the model in PyMOL