Diaphorina citri psyllid: psy11793


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MMVNMPMLVVNSFYQRVIGWETGCDIYGLFGSISGFGSAMNNAVIAYDRYRTKSLKTPSNLFIFNQALLDLCMMVNMPMLVVNSFYQRVIGWETGCDIYGLFGSISGFGSAMNNAVIAYDRYR
ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
***NMPMLVVNSFYQRVIGWETGCDIYGLFGSISGFGSAMNNAVIAYDRYRTKSLKTPSNLFIFNQALLDLCMMVNMPMLVVNSFYQRVIGWETGCDIYGLFGSISGFGSAMNNAVIAYDRYR
xxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMVNMPMLVVNSFYQRVIGWETGCDIYGLFGSISGFGSAMNNAVIAYDRYRTKSLKTPSNLFIFNQALLDLCMMVNMPMLVVNSFYQRVIGWETGCDIYGLFGSISGFGSAMNNAVIAYDRYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Opsin, blue-sensitive Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to 11-cis-retinal.confidentP90680

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044424 [CC]intracellular partprobableGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0048519 [BP]negative regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0016028 [CC]rhabdomereprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0007186 [BP]G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0007602 [BP]phototransductionprobableGO:0044700, GO:0051716, GO:0009583, GO:0051606, GO:0009605, GO:0009581, GO:0009314, GO:0050896, GO:0009987, GO:0044763, GO:0009582, GO:0050794, GO:0008150, GO:0065007, GO:0009416, GO:0007165, GO:0023052, GO:0007154, GO:0009628, GO:0050789, GO:0044699
GO:0009584 [BP]detection of visible lightprobableGO:0009581, GO:0009582, GO:0009583, GO:0051606, GO:0009605, GO:0009628, GO:0009314, GO:0050896, GO:0009416, GO:0008150
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z73, chain A
Confidence level:very confident
Coverage over the Query: 23-123
View the alignment between query and template
View the model in PyMOL