Diaphorina citri psyllid: psy11798


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MSTTMSVTGYRLRVETCEDINECLELSNQCAFRCHNVPGSFRCICPYGYALAPDGRHCIDINECKENEGICEDGKCINIAGGVTCECPEGFMLSPNGMKCIDVRQDVCYDSYQEGTCTLLRKQPITVKECCCSMGQAWGRYCLPCPSPNSGEPATFWSHYPKGFFFVLFFLVIFWSILPIYKTIKDITILSVCAYNMKQTTLHYTNFFFLNFLFDALLEHLMKEIARLFVLASLFMQQTETDKQT
ccccccccccECccccccccccccccccccccEEECccccEEEEcccccEEcccccccccccccccccccccccEEECccccEEEEcccccEEcccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccEEEcccccccEEEcccEEEEcccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccc
MSTTMSVTGYRLRVETCEDINECLELSNQCAFRCHNVPGSFRCICPYGYALAPDGRHCIDINECKENEGICEDGKCINIAGGVTCECPEGFMLSPNGMKCIDVRQDVCYDSYQEGTCTLLRKQPITVKECCCSMGQAWGRYCLPCPSPNSGEPATFWSHYPKGFFFVLFFLVIFWSILPIYKTIKDITILSVCAYNMKQTTLHYTNFFFLNFLFDALLEHLMKEIARLFVLASLFM*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTTMSVTGYRLRVETCEDINECLELSNQCAFRCHNVPGSFRCICPYGYALAPDGRHCIDINECKENEGICEDGKCINIAGGVTCECPEGFMLSPNGMKCIDVRQDVCYDSYQEGTCTLLRKQPITVKECCCSMGQAWGRYCLPCPSPNSGEPATFWSHYPKGFFFVLFFLVIFWSILPIYKTIKDITILSVCAYNMKQTTLHYTNFFFLNFLFDALLEHLMKEIARLFVLASLFMQQTETDKQT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005578 [CC]proteinaceous extracellular matrixprobableGO:0005575, GO:0005576, GO:0044421, GO:0031012
GO:0044420 [CC]extracellular matrix partprobableGO:0005575, GO:0031012
GO:0051223 [BP]regulation of protein transportprobableGO:0070201, GO:0051049, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0032880
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0051050 [BP]positive regulation of transportprobableGO:0051049, GO:0065007, GO:0048518, GO:0008150, GO:0032879, GO:0050789
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0051246 [BP]regulation of protein metabolic processprobableGO:0080090, GO:0019222, GO:0060255, GO:0008150, GO:0065007, GO:0050789
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0051130 [BP]positive regulation of cellular component organizationprobableGO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2W86, chain A
Confidence level:very confident
Coverage over the Query: 18-137
View the alignment between query and template
View the model in PyMOL
Template: 1Z1Y, chain A
Confidence level:very confident
Coverage over the Query: 4-140
View the alignment between query and template
View the model in PyMOL
Template: 2YGQ, chain A
Confidence level:confident
Coverage over the Query: 2-102
View the alignment between query and template
View the model in PyMOL
Template: 3DEM, chain A
Confidence level:confident
Coverage over the Query: 60-128,146-219
View the alignment between query and template
View the model in PyMOL