Diaphorina citri psyllid: psy11800

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220

MSAVAPTEAAMALHWASAGPAVVHSTYTGLSETQTYTGLSDSLSLGVSDLNVDECYENPLICLNGRCDNTLGSYRCACQPGYSPSPDGGFCVDRDECRTPGDHDECSQKKKKKKKKKKLYHDECSQNGMCANGMCINMDGSFKCQCKPGFVLSPTGHACIDVDECYENPLICLNGRCDNTLGSYRCACQPGYSPSPDGGFCVDRDECRTPGGKYTAWLFP

ccccccccccccccccccccccECccccccEEEEcccccccccccccccccccccccccccccccEEECccccEEEEcccccEEcccccccccccccccccccccccccccccccccccccccccccccccccEEECccccEEEEcccccEEcccccccccccccccccccccccEEECccccEEEEcccccEEcccccccccccccccccccccCCccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:2000026 [BP]	regulation of multicellular organismal development	probable	GO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]	positive regulation of cellular process	probable	GO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0045595 [BP]	regulation of cell differentiation	probable	GO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0051716 [BP]	cellular response to stimulus	probable	GO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0016023 [CC]	cytoplasmic membrane-bounded vesicle	probable	GO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0022008 [BP]	neurogenesis	probable	GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0005578 [CC]	proteinaceous extracellular matrix	probable	GO:0005575, GO:0005576, GO:0044421, GO:0031012
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UZK, chain A
Confidence level:very confident
Coverage over the Query: 50-202
View the alignment between query and template
View the model in PyMOL

Template: 2VJ3, chain A
Confidence level:very confident
Coverage over the Query: 50-92,119-205
View the alignment between query and template
View the model in PyMOL

Template: 1UZK, chain A
Confidence level:very confident
Coverage over the Query: 32-159
View the alignment between query and template
View the model in PyMOL