Psyllid ID: psy11800
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 220 | ||||||
| 242016322 | 2816 | Fibrillin-2 precursor, putative [Pedicul | 0.604 | 0.047 | 0.515 | 1e-37 | |
| 270001930 | 2865 | hypothetical protein TcasGA2_TC000836 [T | 0.622 | 0.047 | 0.530 | 3e-37 | |
| 189234367 | 2933 | PREDICTED: similar to fibrillin 2 [Tribo | 0.6 | 0.045 | 0.540 | 3e-37 | |
| 328715164 | 3100 | PREDICTED: fibrillin-2-like [Acyrthosiph | 0.604 | 0.042 | 0.512 | 2e-36 | |
| 321472519 | 2762 | hypothetical protein DAPPUDRAFT_315775 [ | 0.854 | 0.068 | 0.418 | 6e-36 | |
| 307166306 | 2876 | Fibrillin-2 [Camponotus floridanus] | 0.740 | 0.056 | 0.485 | 6e-34 | |
| 322786670 | 458 | hypothetical protein SINV_08004 [Solenop | 0.736 | 0.353 | 0.488 | 1e-33 | |
| 332018680 | 2757 | Fibrillin-2 [Acromyrmex echinatior] | 0.736 | 0.058 | 0.483 | 2e-33 | |
| 380016550 | 2868 | PREDICTED: fibrillin-2-like [Apis florea | 0.6 | 0.046 | 0.490 | 1e-32 | |
| 307196014 | 2862 | Fibrillin-2 [Harpegnathos saltator] | 0.718 | 0.055 | 0.477 | 1e-32 |
| >gi|242016322|ref|XP_002428778.1| Fibrillin-2 precursor, putative [Pediculus humanus corporis] gi|212513463|gb|EEB16040.1| Fibrillin-2 precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 162 bits (409), Expect = 1e-37, Method: Compositional matrix adjust.
Identities = 83/161 (51%), Positives = 102/161 (63%), Gaps = 28/161 (17%)
Query: 51 NVDECYENPLICLNGRCDNTLGSYRCACQPGYSPSPDGGFCVDRDECRTPGDHDECSQKK 110
++DEC + C GRC NT GS++C C GY S DG FC+D
Sbjct: 390 DIDECRDRGY-CQGGRCLNTPGSFQCNCPVGYDVSSDGKFCID----------------- 431
Query: 111 KKKKKKKKLYHDECSQNGMCANGMCINMDGSFKCQCKPGFVLSPTGHACIDVDECYENPL 170
HDEC QNGMCANG+C+NM+G+F C+C GFVLSPTGH+C+D+DECYENP
Sbjct: 432 ----------HDECQQNGMCANGVCVNMNGTFTCKCHKGFVLSPTGHSCVDIDECYENPR 481
Query: 171 ICLNGRCDNTLGSYRCACQPGYSPSPDGGFCVDRDECRTPG 211
ICLNGRC N GS+RC C PG++ S DG FC+D+DEC G
Sbjct: 482 ICLNGRCQNVPGSHRCICLPGFTLSEDGTFCIDKDECAETG 522
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270001930|gb|EEZ98377.1| hypothetical protein TcasGA2_TC000836 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189234367|ref|XP_974344.2| PREDICTED: similar to fibrillin 2 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328715164|ref|XP_001945971.2| PREDICTED: fibrillin-2-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|321472519|gb|EFX83489.1| hypothetical protein DAPPUDRAFT_315775 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|307166306|gb|EFN60488.1| Fibrillin-2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|322786670|gb|EFZ13054.1| hypothetical protein SINV_08004 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332018680|gb|EGI59252.1| Fibrillin-2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|380016550|ref|XP_003692245.1| PREDICTED: fibrillin-2-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|307196014|gb|EFN77739.1| Fibrillin-2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 220 | ||||||
| UNIPROTKB|F1NRR1 | 347 | FBN2 "Uncharacterized protein" | 0.586 | 0.371 | 0.413 | 2e-24 | |
| ZFIN|ZDB-GENE-090112-3 | 2868 | fbn2b "fibrillin 2b" [Danio re | 0.681 | 0.052 | 0.470 | 1.4e-35 | |
| UNIPROTKB|D6RJI3 | 1473 | FBN2 "Fibrillin-2" [Homo sapie | 0.681 | 0.101 | 0.470 | 2.1e-34 | |
| UNIPROTKB|F1RKK1 | 2432 | FBN2 "Uncharacterized protein" | 0.681 | 0.061 | 0.470 | 2.8e-34 | |
| UNIPROTKB|I3LJJ0 | 2433 | FBN2 "Uncharacterized protein" | 0.681 | 0.061 | 0.470 | 2.8e-34 | |
| UNIPROTKB|P35556 | 2912 | FBN2 "Fibrillin-2" [Homo sapie | 0.681 | 0.051 | 0.470 | 5.2e-34 | |
| UNIPROTKB|E2RS46 | 2921 | FBN2 "Uncharacterized protein" | 0.681 | 0.051 | 0.470 | 6.6e-34 | |
| MGI|MGI:95490 | 2907 | Fbn2 "fibrillin 2" [Mus muscul | 0.681 | 0.051 | 0.464 | 8.4e-34 | |
| UNIPROTKB|F1MTZ4 | 3672 | Bt.110891 "Uncharacterized pro | 0.681 | 0.040 | 0.464 | 1.1e-33 | |
| RGD|620910 | 2906 | Fbn2 "fibrillin 2" [Rattus nor | 0.681 | 0.051 | 0.464 | 1.4e-33 |
| UNIPROTKB|F1NRR1 FBN2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 279 (103.3 bits), Expect = 2.0e-24, P = 2.0e-24
Identities = 60/145 (41%), Positives = 74/145 (51%)
Query: 52 VDECYENPLICLNGRCDNTLGSYRCACQPGYSPSPDGGFCVDRDEC-----------RTP 100
+D C +P +CLNGRC T+ SYRC C GY +G C+D DEC TP
Sbjct: 205 IDICKHHPNLCLNGRCIPTISSYRCECNMGYKQDANGD-CIDVDECTSNPCSNGDCVNTP 263
Query: 101 GDHD-ECSQXXXXXXXXXXLYH-DECSQNG-MCANGMCINMDGSFKCQCKPGFVLSPTGH 157
G + +C DEC QNG +C NG C+N DGSF+C C GF L+ G
Sbjct: 264 GSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGK 323
Query: 158 ACIDVDECYENPLICLNGRCDNTLG 182
C+D DEC + CLNG C N G
Sbjct: 324 NCVDHDECTTTNM-CLNGMCINEDG 347
|
|
| ZFIN|ZDB-GENE-090112-3 fbn2b "fibrillin 2b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RJI3 FBN2 "Fibrillin-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RKK1 FBN2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LJJ0 FBN2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P35556 FBN2 "Fibrillin-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RS46 FBN2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:95490 Fbn2 "fibrillin 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MTZ4 Bt.110891 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|620910 Fbn2 "fibrillin 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 220 | |||
| pfam12662 | 24 | pfam12662, cEGF, Complement Clr-like EGF-like | 1e-05 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 1e-05 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 2e-05 | |
| smart00181 | 35 | smart00181, EGF, Epidermal growth factor-like doma | 2e-05 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 3e-05 | |
| pfam07645 | 42 | pfam07645, EGF_CA, Calcium-binding EGF domain | 4e-05 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 5e-05 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 7e-05 | |
| pfam12662 | 24 | pfam12662, cEGF, Complement Clr-like EGF-like | 2e-04 | |
| pfam12662 | 24 | pfam12662, cEGF, Complement Clr-like EGF-like | 2e-04 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 2e-04 | |
| pfam07645 | 42 | pfam07645, EGF_CA, Calcium-binding EGF domain | 3e-04 | |
| pfam07645 | 42 | pfam07645, EGF_CA, Calcium-binding EGF domain | 0.001 | |
| cd01475 | 224 | cd01475, vWA_Matrilin, VWA_Matrilin: In cartilagin | 0.001 | |
| smart00181 | 35 | smart00181, EGF, Epidermal growth factor-like doma | 0.003 | |
| smart00181 | 35 | smart00181, EGF, Epidermal growth factor-like doma | 0.003 | |
| cd00053 | 36 | cd00053, EGF, Epidermal growth factor domain, foun | 0.004 |
| >gnl|CDD|221695 pfam12662, cEGF, Complement Clr-like EGF-like | Back alignment and domain information |
|---|
Score = 40.5 bits (96), Expect = 1e-05
Identities = 12/24 (50%), Positives = 15/24 (62%)
Query: 141 SFKCQCKPGFVLSPTGHACIDVDE 164
S+ C C PG+ LS G C D+DE
Sbjct: 1 SYTCSCPPGYQLSGDGRTCEDIDE 24
|
cEGF, or complement Clr-like EGF, domains have six conserved cysteine residues disulfide-bonded into the characteristic pattern 'ababcc'. They are found in blood coagulation proteins such as fibrillin, Clr and Cls, thrombomodulin, and the LDL receptor. The core fold of the EGF domain consists of two small beta-hairpins packed against each other. Two major structural variants have been identified based on the structural context of the C-terminal cysteine residue of disulfide 'c' in the C-terminal hairpin: hEGFs and cEGFs. In cEGFs the C-terminal thiol resides on the C-terminal beta-sheet, resulting in long loop-lengths between the cysteine residues of disulfide 'c', typically C[10+]XC. These longer loop-lengths may have arisen by selective cysteine loss from a four-disulfide EGF template such as laminin or integrin. Tandem cEGF domains have five linking residues between terminal cysteines of adjacent domains. cEGF domains may or may not bind calcium in the linker region. cEGF domains with the consensus motif CXN4X[F,Y]XCXC are hydroxylated exclusively on the asparagine residue. Length = 24 |
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|214544 smart00181, EGF, Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|221695 pfam12662, cEGF, Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >gnl|CDD|221695 pfam12662, cEGF, Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain | Back alignment and domain information |
|---|
| >gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain | Back alignment and domain information |
|---|
| >gnl|CDD|238752 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >gnl|CDD|214544 smart00181, EGF, Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|214544 smart00181, EGF, Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 220 | |||
| KOG1214|consensus | 1289 | 99.65 | ||
| KOG1219|consensus | 4289 | 99.35 | ||
| KOG1214|consensus | 1289 | 99.13 | ||
| KOG1219|consensus | 4289 | 99.01 | ||
| KOG1217|consensus | 487 | 98.87 | ||
| KOG4289|consensus | 2531 | 98.65 | ||
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 98.61 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 98.6 | |
| KOG1217|consensus | 487 | 98.59 | ||
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 98.45 | |
| KOG4289|consensus | 2531 | 98.29 | ||
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 98.14 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 98.13 | |
| KOG4260|consensus | 350 | 98.12 | ||
| KOG4260|consensus | 350 | 98.02 | ||
| KOG1225|consensus | 525 | 97.92 | ||
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 97.77 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 97.74 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.7 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.62 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 97.57 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.41 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.36 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.31 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.03 | |
| KOG1225|consensus | 525 | 97.02 | ||
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 96.99 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 96.76 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 96.56 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 96.53 | |
| KOG0994|consensus | 1758 | 96.24 | ||
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 96.15 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 96.05 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 95.73 | |
| KOG1226|consensus | 783 | 95.4 | ||
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 95.02 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 93.31 | |
| KOG1226|consensus | 783 | 92.11 | ||
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 91.98 | |
| KOG0994|consensus | 1758 | 91.93 | ||
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 89.35 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 85.04 | |
| PF12946 | 37 | EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 | 83.31 |
| >KOG1214|consensus | Back alignment and domain information |
|---|
Probab=99.65 E-value=1.3e-15 Score=131.73 Aligned_cols=141 Identities=37% Similarity=0.748 Sum_probs=110.7
Q ss_pred ccccc--cCCCCCCCCCCCCccCCCCCCC-CCCeeeeCCCceEeeCCCCCccCCCCCCccCCCcccCCCCCCcccccccc
Q psy11800 36 YTGLS--DSLSLGVSDLNVDECYENPLIC-LNGRCDNTLGSYRCACQPGYSPSPDGGFCVDRDECRTPGDHDECSQKKKK 112 (220)
Q Consensus 36 ~~~~~--~~~~~g~~C~~i~~C~~~~~~C-~~~~C~~~~g~~~C~C~~g~~~~~~~~~C~~~~~C~~~~~~~~C~c~~~~ 112 (220)
|++++ ..+.+|.+|.++++|+..++.| .+..|++.+++|+|.|..||....++.+|..+..=.+
T Consensus 716 ~tcecs~g~~gdgr~c~d~~eca~~~~~CGp~s~Cin~pg~~rceC~~gy~F~dd~~tCV~i~~pap------------- 782 (1289)
T KOG1214|consen 716 YTCECSSGYQGDGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRHTCVLITPPAP------------- 782 (1289)
T ss_pred eEEEEeeccCCCCCCCCChhhhccCCCCCCCCceeecCCCceeEEEeecceeccCCcceEEecCCCC-------------
Confidence 45555 5666788999999999988889 8899999999999999999998888888876522111
Q ss_pred ccccccccccccCCC-CCC-CC--ceEecCC-CCeEeecCCCcEeCCCCCceeecCcCCCCCCCCCC-CeEecCCCCeEE
Q psy11800 113 KKKKKKLYHDECSQN-GMC-AN--GMCINMD-GSFKCQCKPGFVLSPTGHACIDVDECYENPLICLN-GRCDNTLGSYRC 186 (220)
Q Consensus 113 ~~~~~~~~~~~C~~~-~~c-~~--~~C~~~~-~~~~C~C~~G~~~~~~g~~C~~i~~C~~~~~~C~~-~~C~~~~~~~~C 186 (220)
.+.|... ..| .+ +.|+... +.|.|.|.+||.+ +|..|.++|+|.++. |+. +.|.+++++|.|
T Consensus 783 --------~n~Ce~g~h~C~i~g~a~c~~hGgs~y~C~CLPGfsG--DG~~c~dvDeC~psr--Chp~A~CyntpgsfsC 850 (1289)
T KOG1214|consen 783 --------ANPCEDGSHTCAIAGQARCVHHGGSTYSCACLPGFSG--DGHQCTDVDECSPSR--CHPAATCYNTPGSFSC 850 (1289)
T ss_pred --------CCccccCccccCcCCceEEEecCCceEEEeecCCccC--CccccccccccCccc--cCCCceEecCCCccee
Confidence 1445433 333 22 4666554 5699999999976 789999999998665 985 899999999999
Q ss_pred eCCCCCccCCCCCCCCc
Q psy11800 187 ACQPGYSPSPDGGFCVD 203 (220)
Q Consensus 187 ~C~~G~~~~~~g~~C~~ 203 (220)
+|.+||. .+|..|.+
T Consensus 851 ~C~pGy~--GDGf~CVP 865 (1289)
T KOG1214|consen 851 RCQPGYY--GDGFQCVP 865 (1289)
T ss_pred ecccCcc--CCCceecC
Confidence 9999998 57888853
|
|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 220 | ||||
| 1emn_A | 82 | Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epide | 3e-12 | ||
| 1lmj_A | 86 | Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2 | 1e-11 | ||
| 1uzj_A | 162 | Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Hu | 1e-07 | ||
| 1uzk_A | 162 | Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Hu | 1e-07 | ||
| 2vj3_A | 135 | Human Notch-1 Egfs 11-13 Length = 135 | 3e-06 | ||
| 3v65_B | 386 | Crystal Structure Of Agrin And Lrp4 Complex Length | 4e-06 | ||
| 2w86_A | 147 | Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2 | 4e-06 | ||
| 1toz_A | 116 | Nmr Structure Of The Human Notch-1 Ligand Binding R | 5e-06 | ||
| 2bo2_A | 143 | Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune Syst | 4e-05 | ||
| 1z6c_A | 87 | Solution Structure Of An Egf Pair (Egf34) From Vita | 1e-04 |
| >pdb|1EMN|A Chain A, Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epidermal Growth Factor-Like Domains, Minimized Average Structure Length = 82 | Back alignment and structure |
|
| >pdb|1LMJ|A Chain A, Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2+ Binding Epidermal Growth Factor-like Domains Length = 86 | Back alignment and structure |
| >pdb|1UZJ|A Chain A, Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Human Fibrillin-1, Holo Form. Length = 162 | Back alignment and structure |
| >pdb|1UZK|A Chain A, Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Human Fibrillin-1, Ca Bound To Cbegf23 Domain Only Length = 162 | Back alignment and structure |
| >pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 | Back alignment and structure |
| >pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 | Back alignment and structure |
| >pdb|2W86|A Chain A, Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2cbegf10, Calcium Saturated Form Length = 147 | Back alignment and structure |
| >pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 | Back alignment and structure |
| >pdb|2BO2|A Chain A, Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune System Molecule, In Complex With Calcium. Length = 143 | Back alignment and structure |
| >pdb|1Z6C|A Chain A, Solution Structure Of An Egf Pair (Egf34) From Vitamin K- Dependent Protein S Length = 87 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 220 | |||
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 1e-37 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 2e-21 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 6e-10 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 6e-33 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 6e-16 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 3e-10 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 2e-26 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 3e-16 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 6e-04 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 2e-26 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 2e-22 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 2e-12 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 8e-24 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 2e-20 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 6e-14 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 6e-23 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 2e-17 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 3e-12 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 9e-23 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 5e-17 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 2e-20 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 1e-12 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 2e-05 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 2e-19 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 4e-13 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 9e-06 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 7e-16 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 1e-08 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 1e-15 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 4e-04 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 8e-14 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 8e-10 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 1e-13 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 1e-05 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 1e-04 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 2e-12 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 3e-05 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 2e-12 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 1e-10 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 1e-06 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 8e-12 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 1e-10 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 2e-10 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 9e-09 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 8e-10 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 8e-10 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 5e-08 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 2e-09 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 8e-09 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 4e-06 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 2e-08 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 5e-04 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 9e-08 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 9e-06 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 3e-06 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 5e-05 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 6e-05 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 5e-06 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 4e-04 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 2e-05 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 2e-05 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 1e-04 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 3e-05 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 3e-04 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 8e-04 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 6e-05 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 4e-04 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 4e-04 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 1e-04 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 2e-04 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 8e-04 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 2e-04 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 3e-04 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 7e-04 |
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
Score = 127 bits (322), Expect = 1e-37
Identities = 44/160 (27%), Positives = 59/160 (36%), Gaps = 11/160 (6%)
Query: 52 VDECYENPLICLNGRCDNTLGSYRCACQPGYSPSPDGGFCVDRDECRTPGDHD------- 104
V+EC +P C++G C NT GSY C C P + +P CVD D
Sbjct: 3 VNEC-LDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGD 61
Query: 105 ---ECSQKKKKKKKKKKLYHDECSQNGMCANGMCINMDGSFKCQCKPGFVLSPTGHACID 161
K + + C GF +P D
Sbjct: 62 TACSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILED 121
Query: 162 VDECYENPLICLNGRCDNTLGSYRCACQPGYSPSPDGGFC 201
+DEC E P +C G+C NT GS++C C GY + D C
Sbjct: 122 IDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVC 161
|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 170 | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 170 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 220 | |||
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.84 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 99.79 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 99.79 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.74 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.74 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.72 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 99.72 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 99.68 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 99.57 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 99.54 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.53 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 99.52 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.51 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 99.48 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 99.47 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 99.45 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 99.4 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.4 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.4 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.35 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 99.35 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 99.33 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 99.31 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 99.3 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 99.25 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 99.25 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.25 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 99.23 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 99.22 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.22 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 99.19 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 99.19 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 99.19 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 99.18 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.17 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 99.15 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 99.15 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 99.14 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 99.14 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.13 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 99.1 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.09 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 99.05 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 99.01 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 99.0 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.98 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.93 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.87 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 98.85 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.84 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 98.83 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 98.76 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 98.69 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 98.63 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.59 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 98.52 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.51 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.47 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.44 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 98.39 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.38 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 98.36 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.3 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.3 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 98.27 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 98.26 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 98.26 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 98.14 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 98.12 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 98.1 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 97.98 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 97.98 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 97.96 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 97.96 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 97.94 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 97.9 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 97.9 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.87 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 97.85 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 97.81 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 97.8 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 97.76 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 97.76 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 97.74 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 97.68 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 97.68 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.67 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 97.67 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 97.52 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.37 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 97.35 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 97.3 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.27 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 97.24 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 97.21 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 97.13 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 97.03 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 96.92 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 96.86 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 96.78 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 96.59 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 96.47 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 96.29 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 96.24 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 96.03 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 95.75 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 95.68 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 95.62 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 95.58 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 95.55 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 95.51 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 95.45 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 95.43 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 94.99 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 94.76 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 94.66 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 94.65 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 94.52 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 94.33 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 94.29 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 94.26 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 94.12 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 93.77 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 93.75 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 93.71 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 93.15 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 92.62 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 92.54 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 92.21 | |
| 1b9w_A | 95 | Protein (merozoite surface protein 1); MSP-1, cand | 91.98 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 91.92 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 91.89 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 91.59 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 91.42 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 91.37 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 91.16 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 90.94 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 90.68 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 90.61 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 90.54 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 90.19 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 88.97 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 88.4 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 88.05 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 87.95 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 86.29 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 84.6 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 83.29 |
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
Probab=99.84 E-value=2.2e-20 Score=133.26 Aligned_cols=124 Identities=36% Similarity=0.914 Sum_probs=94.7
Q ss_pred CCCCCccCCCCCCC-CCCeeeeCCCceEeeCCCCCccCCCCCCccCCCcccCCCCCCccccccccccccccccccccCCC
Q psy11800 49 DLNVDECYENPLIC-LNGRCDNTLGSYRCACQPGYSPSPDGGFCVDRDECRTPGDHDECSQKKKKKKKKKKLYHDECSQN 127 (220)
Q Consensus 49 C~~i~~C~~~~~~C-~~~~C~~~~g~~~C~C~~g~~~~~~~~~C~~~~~C~~~~~~~~C~c~~~~~~~~~~~~~~~C~~~ 127 (220)
|++||+|...+.+| .++.|+++.++|+|.|++||. +..|+ .++++|...
T Consensus 2 c~dideC~~~~~~C~~~g~C~~~~g~~~C~C~~Gy~----G~~C~--------------------------~~~~~C~~~ 51 (135)
T 2vj3_A 2 AQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYT----GPRCE--------------------------IDVNECVSN 51 (135)
T ss_dssp -CCCCTTTSSSCSSSTTCEEEECSSSEEEECCTTEE----STTSC--------------------------EECCTTTTC
T ss_pred CcccccccCCCCCCCCCCEeECCCCCEEEECCCCCc----CCccc--------------------------ccCccCCCC
Confidence 67899999544459 669999999999999999998 44553 123555444
Q ss_pred CCCCCceEecCCCCeEeecCCCcEeCCCCCce-eecCcCCCCCCCCCC-CeEecCCCCeEEeCCCCCccCCCCCCCC-cC
Q psy11800 128 GMCANGMCINMDGSFKCQCKPGFVLSPTGHAC-IDVDECYENPLICLN-GRCDNTLGSYRCACQPGYSPSPDGGFCV-DR 204 (220)
Q Consensus 128 ~~c~~~~C~~~~~~~~C~C~~G~~~~~~g~~C-~~i~~C~~~~~~C~~-~~C~~~~~~~~C~C~~G~~~~~~g~~C~-~~ 204 (220)
.+-.+++|++..++|+|.|++|| .|..| .++++|...+ |.+ ++|++..++|.|.|++||. |..|+ ++
T Consensus 52 ~C~~~~~C~~~~g~~~C~C~~G~----~G~~C~~~~~~C~~~~--C~~~g~C~~~~g~~~C~C~~G~~----G~~C~~~i 121 (135)
T 2vj3_A 52 PCQNDATCLDQIGEFQCICMPGY----EGVHCEVNTDECASSP--CLHNGRCLDKINEFQCECPTGFT----GHLCQVDL 121 (135)
T ss_dssp CCCSSCEEEECSSCEEEECCTTE----ESSSSCEECCTTTTCC--STTTCEEEECSSCEEEECCTTEE----SSSSCEEC
T ss_pred CCCCCCEEeCCCCCceeeCCCCC----cCCcceecCCcccCCC--cCCCCEeECCCCCeEEECCCCCc----CCccCccC
Confidence 33345799999999999999999 67788 4899998766 986 8999999999999999999 89996 89
Q ss_pred CCCCCCCC
Q psy11800 205 DECRTPGG 212 (220)
Q Consensus 205 ~~C~~~~~ 212 (220)
++|+..++
T Consensus 122 ~~C~~~~~ 129 (135)
T 2vj3_A 122 HHILDAQK 129 (135)
T ss_dssp C-------
T ss_pred ccccCCCc
Confidence 99987653
|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 220 | ||||
| d1lmja2 | 42 | g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien | 1e-10 | |
| d1lmja2 | 42 | g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien | 1e-09 | |
| d1lmja2 | 42 | g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien | 1e-08 | |
| d1uzka2 | 43 | g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa | 8e-10 | |
| d1uzka2 | 43 | g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa | 6e-09 | |
| d1uzka2 | 43 | g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa | 9e-08 | |
| d1uzka1 | 43 | g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa | 6e-09 | |
| d1uzka1 | 43 | g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa | 3e-08 | |
| d1uzka1 | 43 | g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa | 2e-07 | |
| d1lmja1 | 44 | g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens | 2e-08 | |
| d1lmja1 | 44 | g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens | 1e-07 | |
| d1lmja1 | 44 | g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens | 3e-06 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 5e-08 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 6e-07 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 9e-06 | |
| d1i0ua2 | 41 | g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r | 8e-08 | |
| d1i0ua2 | 41 | g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r | 6e-05 | |
| d1i0ua2 | 41 | g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r | 6e-05 | |
| d1apqa_ | 53 | g.3.11.1 (A:) Complement protease C1R {Human (Homo | 2e-06 | |
| d1apqa_ | 53 | g.3.11.1 (A:) Complement protease C1R {Human (Homo | 5e-05 | |
| d1apqa_ | 53 | g.3.11.1 (A:) Complement protease C1R {Human (Homo | 2e-04 | |
| d1szba2 | 45 | g.3.11.1 (A:124-168) Mannose-binding protein assoc | 4e-06 | |
| d1szba2 | 45 | g.3.11.1 (A:124-168) Mannose-binding protein assoc | 4e-06 | |
| d1szba2 | 45 | g.3.11.1 (A:124-168) Mannose-binding protein assoc | 1e-05 | |
| d1kigl_ | 51 | g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo | 5e-06 | |
| d1kigl_ | 51 | g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo | 1e-04 | |
| d1kigl_ | 51 | g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo | 1e-04 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 2e-05 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 1e-04 | |
| d2p3ua1 | 51 | g.3.11.1 (A:87-137) Factor X, N-terminal module {H | 3e-05 | |
| d2p3ua1 | 51 | g.3.11.1 (A:87-137) Factor X, N-terminal module {H | 7e-04 | |
| d2p3ua1 | 51 | g.3.11.1 (A:87-137) Factor X, N-terminal module {H | 7e-04 | |
| d1autl2 | 50 | g.3.11.1 (L:97-146) Activated protein c (autoproth | 4e-05 | |
| d1autl2 | 50 | g.3.11.1 (L:97-146) Activated protein c (autoproth | 0.002 | |
| d1autl2 | 50 | g.3.11.1 (L:97-146) Activated protein c (autoproth | 0.002 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 5e-05 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 5e-04 | |
| d1dx5i3 | 40 | g.3.11.1 (I:423-462) Thrombomodulin, different EGF | 5e-05 | |
| d1dx5i3 | 40 | g.3.11.1 (I:423-462) Thrombomodulin, different EGF | 3e-04 | |
| d1dx5i3 | 40 | g.3.11.1 (I:423-462) Thrombomodulin, different EGF | 0.002 | |
| d1nt0a3 | 45 | g.3.11.1 (A:120-164) Mannose-binding protein assoc | 2e-04 | |
| d1nt0a3 | 45 | g.3.11.1 (A:120-164) Mannose-binding protein assoc | 2e-04 | |
| d1nt0a3 | 45 | g.3.11.1 (A:120-164) Mannose-binding protein assoc | 3e-04 | |
| d1nzia2 | 42 | g.3.11.1 (A:118-159) Complement C1S component {Hum | 3e-04 | |
| d1nzia2 | 42 | g.3.11.1 (A:118-159) Complement C1S component {Hum | 6e-04 | |
| d1nzia2 | 42 | g.3.11.1 (A:118-159) Complement C1S component {Hum | 6e-04 | |
| d1rfnb_ | 57 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 4e-04 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 4e-04 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 0.003 | |
| d1emoa2 | 39 | g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sa | 0.001 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 0.001 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 0.001 | |
| d1autl1 | 48 | g.3.11.1 (L:49-96) Activated protein c (autoprothr | 0.002 | |
| d1autl1 | 48 | g.3.11.1 (L:49-96) Activated protein c (autoprothr | 0.003 | |
| d2bz6l1 | 53 | g.3.11.1 (L:90-142) Coagulation factor VIIa {Human | 0.003 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 0.004 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 0.004 |
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Fibrillin-1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 52.5 bits (126), Expect = 1e-10
Identities = 22/42 (52%), Positives = 28/42 (66%)
Query: 161 DVDECYENPLICLNGRCDNTLGSYRCACQPGYSPSPDGGFCV 202
D+DEC +PL+C G C NT GSYRC C PG+ SP+ C+
Sbjct: 1 DIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISACI 42
|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 220 | |||
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 99.04 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.99 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.94 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.9 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.87 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.84 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.8 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 98.8 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.79 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 98.7 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 98.7 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.69 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.69 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.68 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.66 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.66 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.65 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 98.64 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 98.63 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 98.59 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.57 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.53 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.5 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 98.48 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.47 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 98.46 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.46 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 98.44 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.4 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 98.4 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 98.4 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.31 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.23 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 98.21 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.2 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 98.2 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 98.19 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.18 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 98.15 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 98.11 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.06 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.0 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 97.98 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 97.98 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 97.96 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.96 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.95 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 97.93 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 97.78 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 97.77 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 97.72 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 97.69 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 97.68 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 97.66 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 97.63 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 97.63 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 97.54 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 97.53 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.49 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.4 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.39 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.36 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 97.34 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 97.33 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 97.01 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 96.96 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 96.89 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 96.48 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 96.35 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 95.96 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 95.75 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 94.14 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 93.89 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 93.8 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 92.61 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 90.54 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 89.35 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 89.26 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 85.79 |
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Fibrillin-1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.04 E-value=4.8e-11 Score=64.95 Aligned_cols=41 Identities=54% Similarity=1.167 Sum_probs=37.1
Q ss_pred ecCcCCCCCCCCCCCeEecCCCCeEEeCCCCCccCCCCCCC
Q psy11800 161 DVDECYENPLICLNGRCDNTLGSYRCACQPGYSPSPDGGFC 201 (220)
Q Consensus 161 ~i~~C~~~~~~C~~~~C~~~~~~~~C~C~~G~~~~~~g~~C 201 (220)
|||||+..+..|.++.|+|+.|+|.|.|++||.+..+++.|
T Consensus 1 DidEC~~~~~~C~~~~C~Nt~Gsy~C~C~~Gy~l~~d~~~C 41 (42)
T d1lmja2 1 DIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISAC 41 (42)
T ss_dssp ECCHHHHCSSTTTTSEEEEETTEEEEESCTTSCCCSSSCCC
T ss_pred CccccCCCCCCCCCCEeECCCCCeEEeCCCCCeECcCCCcc
Confidence 68999988888888899999999999999999988888776
|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|