Diaphorina citri psyllid: psy11807


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MDNDIMTCKTYCIFIFHEFCIRGWCIVGKKQICPYCKEKVDLKLMFVNLWEKPHVFYGQLLDWLRWLVAWQPVILALIQGVNYMLDLK
ccccccEEEEEcccccHHHHHHHHHHHccccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
****IMTCKTYCIFIFHEFCIRGWCIVGKKQICPYCKEKVDLKLMFVNLWEKPHVFYGQLLDWLRWLVAWQPVILALIQGVNYMLDLK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNDIMTCKTYCIFIFHEFCIRGWCIVGKKQICPYCKEKVDLKLMFVNLWEKPHVFYGQLLDWLRWLVAWQPVILALIQGVNYMLDLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RING finger protein 121 confidentQ8R1Z9
RING finger protein 121 confidentQ6P360
RING finger protein 121 confidentQ9H920

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0033017 [CC]sarcoplasmic reticulum membraneprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0016528, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0016529, GO:0044424, GO:0044425, GO:0044422
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ECT, chain A
Confidence level:confident
Coverage over the Query: 2-53
View the alignment between query and template
View the model in PyMOL