Diaphorina citri psyllid: psy11815


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSDLTGGPDQVYLIVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGSLG
cccccEEEEEEEcccccccEEEEEEEECcccccccEEEEEEECccccccEEEECcccccccccCEEEEEEEEEEEcccccccccccEEEEEEEcccccccEEEEEEEECcccccccEEEEEEEcccccccEEECcccCEEc
MTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSDLTGGPDQVYLIVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGSL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSDLTGGPDQVYLIVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGSLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0044700 [BP]single organism signalingprobableGO:0008150, GO:0023052, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q55, chain A
Confidence level:very confident
Coverage over the Query: 1-141
View the alignment between query and template
View the model in PyMOL