Psyllid ID: psy11815

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSDLTGGPDQVYLIVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGSLG
cccccEEEEEEEcccccccEEEEEEEEEcccccccEEEEEEEEccccccEEEEEcccccccccEEEEEEEEEEEEcccccccccccEEEEEEEcccccccEEEEEEEEEcccccccEEEEEEEcccccccEEEEcccEEEc
cccccEEEEEEEcccccccEEEEEEEEccccccccEEEEEEEccccccEEEEcccccccccccccEEEEEEEEEEccccccccccccEEEEEccccccccEEEEEEEEccccccccEEEEEEEccccccEEEEcccccEEc
MTLDPVYYAQIVEnqsgilpivqlaasdgdldpdqrisykisagnpesyfnidigsdltggpdqVYLIVYIQVQnvndnvpmtldPVYYAQIVEnqsgilpivqlaasdgdldpdqrisykisagnpesyfnidigsgslg
MTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKisagnpesyFNIDIGSDLTGGPDQVYLIVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISykisagnpesyfnidigsgslg
MTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSDLTGGPDQVYLIVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGSLG
****PVYYAQIVENQSGILPIVQLAASDGDL****RISYKISAGNPESYFNIDIGSDLTGGPDQVYLIVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAAS*********************YF**********
MTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSDLTGGPDQVYLIVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGSL*
MTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSDLTGGPDQVYLIVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGSLG
*TLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSDLTGGPDQVYLIVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIG*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSDLTGGPDQVYLIVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGSLG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query141 2.2.26 [Sep-21-2011]
Q8BNA6 4555 Protocadherin Fat 3 OS=Mu yes N/A 0.907 0.028 0.302 3e-14
Q8R508 4555 Protocadherin Fat 3 OS=Ra yes N/A 0.907 0.028 0.309 4e-14
Q8TDW7 4589 Protocadherin Fat 3 OS=Ho yes N/A 0.907 0.027 0.302 1e-13
Q9VW71 4705 Fat-like cadherin-related yes N/A 0.957 0.028 0.333 4e-13
Q14517 4588 Protocadherin Fat 1 OS=Ho no N/A 0.319 0.009 0.402 7e-12
Q9HCU4 2923 Cadherin EGF LAG seven-pa no N/A 0.971 0.046 0.257 2e-08
Q9R0M0 2920 Cadherin EGF LAG seven-pa no N/A 0.971 0.046 0.257 4e-08
O88278 3313 Cadherin EGF LAG seven-pa no N/A 0.943 0.040 0.271 5e-08
Q91ZI0 3301 Cadherin EGF LAG seven-pa no N/A 0.943 0.040 0.271 6e-08
Q9NYQ7 3312 Cadherin EGF LAG seven-pa no N/A 0.943 0.040 0.271 1e-07
>sp|Q8BNA6|FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus GN=Fat3 PE=1 SV=2 Back     alignment and function desciption
 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 79/152 (51%), Gaps = 24/152 (15%)

Query: 11   IVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSDLTGGPDQV----- 65
            + EN      ++Q+ A D D   D  I Y I  G+    FNID  S +    D +     
Sbjct: 1051 VKENSRIGTSVLQVTAHDEDSGRDGEIQYSIRDGSGLGRFNIDDESGVITAADSLDRETT 1110

Query: 66   --YLI-----------------VYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLA 106
              Y +                 VYI+V++VNDN P+T +P+YY  ++EN    + ++Q+ 
Sbjct: 1111 ASYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQ 1170

Query: 107  ASDGDLDPDQRISYKISAGNPESYFNIDIGSG 138
            A D D   +++++Y+I++GNP+++F I+I +G
Sbjct: 1171 AEDPDSGSNEKLTYRITSGNPQNFFAINIKTG 1202
May play a role in the interactions between neurites derived from specific subsets of neurons during development.
Mus musculus (taxid: 10090)
>sp|Q8R508|FAT3_RAT Protocadherin Fat 3 OS=Rattus norvegicus GN=Fat3 PE=1 SV=1 Back     alignment and function description
>sp|Q8TDW7|FAT3_HUMAN Protocadherin Fat 3 OS=Homo sapiens GN=FAT3 PE=2 SV=2 Back     alignment and function description
>sp|Q9VW71|FAT2_DROME Fat-like cadherin-related tumor suppressor homolog OS=Drosophila melanogaster GN=kug PE=2 SV=2 Back     alignment and function description
>sp|Q14517|FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens GN=FAT1 PE=1 SV=2 Back     alignment and function description
>sp|Q9HCU4|CELR2_HUMAN Cadherin EGF LAG seven-pass G-type receptor 2 OS=Homo sapiens GN=CELSR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9R0M0|CELR2_MOUSE Cadherin EGF LAG seven-pass G-type receptor 2 OS=Mus musculus GN=Celsr2 PE=1 SV=2 Back     alignment and function description
>sp|O88278|CELR3_RAT Cadherin EGF LAG seven-pass G-type receptor 3 OS=Rattus norvegicus GN=Celsr3 PE=2 SV=1 Back     alignment and function description
>sp|Q91ZI0|CELR3_MOUSE Cadherin EGF LAG seven-pass G-type receptor 3 OS=Mus musculus GN=Celsr3 PE=2 SV=2 Back     alignment and function description
>sp|Q9NYQ7|CELR3_HUMAN Cadherin EGF LAG seven-pass G-type receptor 3 OS=Homo sapiens GN=CELSR3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
242006694 4716 protocadherin fat 2 precursor, putative 0.765 0.022 0.419 2e-15
195022843 4534 GH17186 [Drosophila grimshawi] gi|193899 0.971 0.030 0.360 5e-15
195129685 2436 GI13952 [Drosophila mojavensis] gi|19392 0.971 0.056 0.329 1e-13
195378480 4641 GJ13735 [Drosophila virilis] gi|19415517 0.971 0.029 0.347 2e-13
170069415133 conserved hypothetical protein [Culex qu 0.659 0.699 0.440 5e-13
328703041 4147 PREDICTED: fat-like cadherin-related tum 0.829 0.028 0.352 6e-13
328703039 4140 PREDICTED: fat-like cadherin-related tum 0.829 0.028 0.352 6e-13
440903408 4588 Protocadherin Fat 1 [Bos grunniens mutus 0.836 0.025 0.309 1e-12
300794923 4588 protocadherin Fat 1 precursor [Bos tauru 0.836 0.025 0.309 1e-12
296472443 4588 TPA: FAT tumor suppressor homolog 1-like 0.836 0.025 0.309 1e-12
>gi|242006694|ref|XP_002424182.1| protocadherin fat 2 precursor, putative [Pediculus humanus corporis] gi|212507523|gb|EEB11444.1| protocadherin fat 2 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/136 (41%), Positives = 76/136 (55%), Gaps = 28/136 (20%)

Query: 30   DLDP---DQRISYKISAGNPESYFNID-----------------------IGSDLTGGPD 63
            D DP   D ++SY I  G+   YF+ID                          D    P 
Sbjct: 1158 DQDPPGDDSKVSYYIKGGDGVGYFSIDENGQIKTLAVFDVETKSHYWLTVYAEDHGVIPL 1217

Query: 64   QVYLIVYIQVQNVNDNVPMTLDPVYYAQIVEN-QSGILPIVQLAASDGDLDPDQRISYKI 122
               L VY+ ++NVNDN P+T +P+YYA + EN +SG L IV+L+A+D DLDP+ +I YKI
Sbjct: 1218 SSRLEVYVAIENVNDNSPLTDEPIYYASVPENSESGKL-IVELSATDADLDPNNKIFYKI 1276

Query: 123  SAGNPESYFNIDIGSG 138
            +AGNP+SYF ID  SG
Sbjct: 1277 TAGNPQSYFTIDSISG 1292

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195022843|ref|XP_001985650.1| GH17186 [Drosophila grimshawi] gi|193899132|gb|EDV97998.1| GH17186 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195129685|ref|XP_002009286.1| GI13952 [Drosophila mojavensis] gi|193920895|gb|EDW19762.1| GI13952 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195378480|ref|XP_002048012.1| GJ13735 [Drosophila virilis] gi|194155170|gb|EDW70354.1| GJ13735 [Drosophila virilis] Back     alignment and taxonomy information
>gi|170069415|ref|XP_001869219.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167865287|gb|EDS28670.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|328703041|ref|XP_003242077.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328703039|ref|XP_003242076.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog isoform 1 [Acyrthosiphon pisum] gi|328703043|ref|XP_003242078.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|440903408|gb|ELR54072.1| Protocadherin Fat 1 [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|300794923|ref|NP_001179921.1| protocadherin Fat 1 precursor [Bos taurus] Back     alignment and taxonomy information
>gi|296472443|tpg|DAA14558.1| TPA: FAT tumor suppressor homolog 1-like [Bos taurus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
UNIPROTKB|F5H8171254 FAT3 "Protocadherin Fat 3" [Ho 0.503 0.056 0.408 2e-16
UNIPROTKB|F1PJH11209 FAT3 "Uncharacterized protein" 0.510 0.059 0.361 9.8e-16
ZFIN|ZDB-GENE-050425-1 4611 fat1 "FAT tumor suppressor hom 0.546 0.016 0.415 1.3e-15
UNIPROTKB|F1NXZ3 4029 FAT3 "Uncharacterized protein" 0.496 0.017 0.385 5.4e-15
UNIPROTKB|F1NXZ5 4557 FAT3 "Uncharacterized protein" 0.496 0.015 0.385 7e-15
UNIPROTKB|E9PQ73 4439 FAT3 "Protocadherin Fat 3" [Ho 0.496 0.015 0.4 8.4e-15
RGD|620657 4555 Fat3 "FAT tumor suppressor hom 0.496 0.015 0.4 8.9e-15
UNIPROTKB|Q8R508 4555 Fat3 "Protocadherin Fat 3" [Ra 0.496 0.015 0.4 8.9e-15
UNIPROTKB|Q8TDW7 4589 FAT3 "Protocadherin Fat 3" [Ho 0.496 0.015 0.4 9e-15
UNIPROTKB|F1NWW5 4592 FAT1 "Uncharacterized protein" 0.546 0.016 0.376 3.8e-14
UNIPROTKB|F5H817 FAT3 "Protocadherin Fat 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 183 (69.5 bits), Expect = 2.0e-16, Sum P(2) = 2.0e-16
 Identities = 29/71 (40%), Positives = 54/71 (76%)

Query:    69 VYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPE 128
             VYI+V++VNDN P+T +P+YY  ++EN    + ++Q+ A D D   +++++Y+I++GNP+
Sbjct:  1134 VYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQ 1193

Query:   129 SYFNIDIGSGS 139
             ++F I+I +GS
Sbjct:  1194 NFFAINIKTGS 1204
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0007156 "homophilic cell adhesion" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
UNIPROTKB|F1PJH1 FAT3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050425-1 fat1 "FAT tumor suppressor homolog 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXZ3 FAT3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXZ5 FAT3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PQ73 FAT3 "Protocadherin Fat 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|620657 Fat3 "FAT tumor suppressor homolog 3 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8R508 Fat3 "Protocadherin Fat 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TDW7 FAT3 "Protocadherin Fat 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWW5 FAT1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 1e-08
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 9e-08
pfam0002892 pfam00028, Cadherin, Cadherin domain 3e-06
smart0011281 smart00112, CA, Cadherin repeats 3e-05
pfam0002892 pfam00028, Cadherin, Cadherin domain 5e-05
smart0011281 smart00112, CA, Cadherin repeats 0.003
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information 
 Score = 49.2 bits (118), Expect = 1e-08
 Identities = 23/98 (23%), Positives = 37/98 (37%), Gaps = 24/98 (24%)

Query: 6  VYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNID------------ 53
           Y   + EN      ++ ++A+D D   +  ++Y I +GN +  F+ID            
Sbjct: 1  SYEVSVPENAPPGTVVLTVSATDPDSGENGEVTYSIVSGNEDGLFSIDPSTGEITTAKPL 60

Query: 54 ------------IGSDLTGGPDQVYLIVYIQVQNVNDN 79
                        +D  G P      V I V +VNDN
Sbjct: 61 DREEQSSYTLTVTATDGGGPPLSSTATVTITVLDVNDN 98

Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 141
KOG4289|consensus 2531 99.98
KOG4289|consensus 2531 99.97
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.96
KOG1219|consensus 4289 99.95
KOG1219|consensus 4289 99.94
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.64
KOG1834|consensus 952 99.56
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.41
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.37
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.18
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 97.86
KOG1834|consensus 952 97.45
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 96.6
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 96.37
TIGR00845 928 caca sodium/calcium exchanger 1. This model is spe 95.07
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 94.79
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 94.58
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 92.32
TIGR0196599 VCBS_repeat VCBS repeat. This domain of about 100 88.22
>KOG4289|consensus Back     alignment and domain information 
Probab=99.98  E-value=7.9e-32  Score=220.05  Aligned_cols=140  Identities=29%  Similarity=0.401  Sum_probs=135.5

Q ss_pred             CCCCCeeEEEEecCCCCCceeEEEEeEECCCCCCCeEEEEEecCCC------------------------CeEEEEEEEE
Q psy11815          1 MTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNP------------------------ESYFNIDIGS   56 (141)
Q Consensus         1 ~f~~~~y~~~V~E~~~~g~~v~~v~a~D~D~~~n~~v~y~i~~~~~------------------------~~y~l~v~a~   56 (141)
                      .|.|..|..++.||.++|+.|.+|+|+|.|.++|+.|+|++.+|+.                        ..|+|.|+|+
T Consensus       268 vFEq~~Y~e~lREn~evGy~vLtvrAtD~Dsp~Nani~Yrl~eg~~~~~f~in~rSGvI~T~a~lDRE~~~~y~L~VeAs  347 (2531)
T KOG4289|consen  268 VFEQDEYREELRENLEVGYEVLTVRATDGDSPPNANIRYRLLEGNAKNVFEINPRSGVISTRAPLDREELESYQLDVEAS  347 (2531)
T ss_pred             ccchhHHHHHHhhccccCceEEEEEeccCCCCCCCceEEEecCCCccceeEEcCccceeeccCccCHHhhhheEEEEEec
Confidence            4899999999999999999999999999999999999999999965                        8999999999


Q ss_pred             ECCCCCCeEEEEEEEEEEeCCCCCCccCCCceEEEEecCCCCCceEEEEEEEECCCCCCCeEEEEEEcCCCCCcEEEeCC
Q psy11815         57 DLTGGPDQVYLIVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIG  136 (141)
Q Consensus        57 d~~~~~~~~~~~v~i~V~d~Nd~~P~f~~~~~~~~v~e~~~~g~~v~~v~a~D~D~~~~~~i~Y~i~~~~~~~~F~Id~~  136 (141)
                      |+|.++...++.|.|+|.|+|||+|+|....|.+.|.|+..+++.|++|+|+|+|.|.|+.+.|+|.+|+..+.|.||..
T Consensus       348 DqG~~pgp~Ta~V~itV~D~NDNaPqFse~~Yvvqv~Edvt~~avvlrV~AtDrD~g~Ng~VHYsi~Sgn~~G~f~id~~  427 (2531)
T KOG4289|consen  348 DQGRPPGPRTAMVEITVEDENDNAPQFSEKRYVVQVREDVTPPAVVLRVTATDRDKGTNGKVHYSIASGNGRGQFYIDSL  427 (2531)
T ss_pred             cCCCCCCCceEEEEEEEEecCCCCccccccceEEEecccCCCCceEEEEEecccCCCcCceEEEEeeccCccccEEEecc
Confidence            99998877899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeEE
Q psy11815        137 SGSL  140 (141)
Q Consensus       137 tG~i  140 (141)
                      ||+|
T Consensus       428 tGel  431 (2531)
T KOG4289|consen  428 TGEL  431 (2531)
T ss_pred             cceE
Confidence            9987

>KOG4289|consensus Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>TIGR00845 caca sodium/calcium exchanger 1 Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>TIGR01965 VCBS_repeat VCBS repeat Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
2a4e_A215 Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length 3e-04
>pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 Back     alignment and structure 
Iteration: 1

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 7/72 (9%)
Query: 71  IQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDP----DQRISYKISAGN 126
           ++VQ++NDN P  L  +Y+A + E  +    ++Q+ ASD D DP      ++ Y I  G 
Sbjct: 95  VKVQDINDNPPEFLHEIYHANVPERSNVGTSVIQVTASDAD-DPTYGNSAKLVYSILEGQ 153
Query: 127 PESYFNIDIGSG 138
           P  YF+++  +G
Sbjct: 154 P--YFSVEAQTG 163

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 7e-18
3qrb_A 213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 3e-05
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 7e-17
3k5r_A 218 Cadherin 13; mouse, structural protein; 2.00A {Mus 6e-05
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 2e-16
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 3e-16
3lnd_A 207 CDH6 protein, cadherin 6; cell adhesion, cell memb 7e-04
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 4e-16
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 7e-04
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 5e-15
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 7e-14
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 7e-14
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-11
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 3e-09
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-04
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 3e-13
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 3e-12
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-10
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 1e-09
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 6e-04
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 8e-13
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-12
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-12
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 3e-11
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 5e-10
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-04
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-04
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-12
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 1e-11
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-10
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 3e-10
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 8e-12
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 1e-11
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 8e-12
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 3e-10
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 4e-09
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 3e-11
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 3e-10
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 5e-04
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 1e-09
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 9e-04
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 4e-07
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 2e-06
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 1e-05
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 4e-06
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 2e-05
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 4e-06
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 2e-04
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 6e-06
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 5e-05
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 1e-05
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 2e-04
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 4e-04
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 7e-04
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
 Score = 75.1 bits (185), Expect = 7e-18
 Identities = 31/168 (18%), Positives = 58/168 (34%), Gaps = 36/168 (21%)

Query: 6   VYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGN----PESYFNID-------- 53
           +      EN+ G  P   L     + D + ++ Y I+       P   F I+        
Sbjct: 4   IAAISCPENEKGEFP-KNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKV 62

Query: 54  ----------------IGSDLTGGPDQVYLIVYIQVQNVNDNVPMTLDPVYYAQIVENQS 97
                                 G   +  + + I V + NDN P     V+   + E   
Sbjct: 63  TQPLDREAIAKYILYSHAVSSNGEAVEDPMEIVITVTDQNDNRPEFTQEVFEGSVAEGAV 122

Query: 98  GILPIVQLAASDGDLDPDQ---RISYKISAGNPES----YFNIDIGSG 138
               +++++A+D D D +     I+Y I + +PE      F ++  +G
Sbjct: 123 PGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTG 170
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 100.0
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 100.0
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 100.0
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 99.97
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.97
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.97
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.97
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.97
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 99.97
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 99.96
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 99.96
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 99.96
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 99.96
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.96
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.95
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 99.95
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 99.95
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 99.95
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.95
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 99.94
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 99.94
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.93
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.88
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 99.83
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.82
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.8
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.8
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 99.79
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.78
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.77
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 99.76
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.64
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.61
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 99.59
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.59
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.59
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.56
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 99.55
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.54
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.53
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.49
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.46
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.45
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.42
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.21
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.18
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.16
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.08
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 98.97
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 98.89
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 98.88
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 98.85
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 98.83
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 98.79
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 98.71
3rb5_A 298 Na/Ca exchange protein; CBD12, calcium binding and 93.17
2yrl_A102 KIAA1837 protein; PKD domain, NPPSFA, national pro 89.03
2yhg_A437 SDE_182CT, cellulose-binding protein; hydrolase, g 86.62
3ead_A137 Na/Ca exchange protein; CBD1, calcium regulation, 86.51
3gin_A160 Sodium/calcium exchanger 1; CBD1, CBD2, NCX, calci 83.48
2wql_A154 Major allergen DAU C 1; pathogenesis-related prote 83.28
3pe9_A98 Fibronectin(III)-like module; CBHA, beta-sandwich, 82.09
3us9_A295 Sodium/calcium exchanger 1; beta-sandwich, calcium 81.91
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=8e-34  Score=210.18  Aligned_cols=141  Identities=23%  Similarity=0.323  Sum_probs=128.5

Q ss_pred             CCCCCeeEEEEecCCCCCceeEEEEeEECCC---CCCCeEEEEEecCCC-----------------------CeEEEEEE
Q psy11815          1 MTLDPVYYAQIVENQSGILPIVQLAASDGDL---DPDQRISYKISAGNP-----------------------ESYFNIDI   54 (141)
Q Consensus         1 ~f~~~~y~~~V~E~~~~g~~v~~v~a~D~D~---~~n~~v~y~i~~~~~-----------------------~~y~l~v~   54 (141)
                      .|.+..|.+.|+|++++|+.|+++.|+|+|.   |.|+.++|+|.++.+                       ..|.|+|.
T Consensus       105 ~F~~~~y~~~v~E~~~~gt~v~~v~A~D~D~~~~G~n~~i~Y~i~~~~~~F~Id~~tG~i~~~~~~LD~E~~~~y~l~V~  184 (322)
T 2a62_A          105 EFLNGPYHATVPEMSILGTSVTNVTATDADDPVYGNSAKLVYSILEGQPYFSIEPETAIIKTALPNMDREAKEEYLVVIQ  184 (322)
T ss_dssp             CCSSSEEEEEECSSCCTTCBCCCCCCCBCSCSSSTTSSCEEEEEEECTTTEEECTTTCCEEECSSCCCGGGCSEEEEEEE
T ss_pred             ccCCCceEEEEeCCCCCCCEEEEEEEEeCCCCCCCccEEEEEEEccCCCCEEEecCCCEEEecccCCCcccCCeEEEEEE
Confidence            4889999999999999999999999999996   789999999987654                       78999999


Q ss_pred             EEECCCCC--CeEEEEEEEEEEeCCCCCCccCCCceEEEEecCCCCCceEEEEEEEECCCCCCCeEEEEEEcCCCCCcEE
Q psy11815         55 GSDLTGGP--DQVYLIVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFN  132 (141)
Q Consensus        55 a~d~~~~~--~~~~~~v~i~V~d~Nd~~P~f~~~~~~~~v~e~~~~g~~v~~v~a~D~D~~~~~~i~Y~i~~~~~~~~F~  132 (141)
                      |+|.+.|+  ++++++|+|+|.|+|||+|.|.+..|.+.|.|+.++|+.|++|.|+|+|.|.|+.++|+|..++..++|.
T Consensus       185 a~D~g~p~~~~s~~~~v~I~V~DvNDn~P~F~~~~y~~~v~En~~~gt~v~~v~A~D~D~g~n~~i~Y~i~~g~~~~~F~  264 (322)
T 2a62_A          185 AKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSLYHFSVPEDVVLGTAIGRVKANDQDIGENAQSSYDIIDGDGTALFE  264 (322)
T ss_dssp             EEESCSSSSCCBCCEEEEEEECCCCCCCCCCSCSEEEEEECSCCSSCCEEEEEECCCSSCGGGTCCEEEEC---CCSSBC
T ss_pred             EEECCCCCCCceeEEEEEEEEEecCCCCCeecCCCceeEeECCCCCCcEEEEEEEEeCCCCCCceEEEEEECCCCCCcEE
Confidence            99999864  8899999999999999999999999999999999999999999999999999999999999888778999


Q ss_pred             Ee----CCCeEEC
Q psy11815        133 ID----IGSGSLG  141 (141)
Q Consensus       133 Id----~~tG~i~  141 (141)
                      |+    +.+|.|.
T Consensus       265 I~~d~~~~tG~i~  277 (322)
T 2a62_A          265 ITSDAQAQDGVIR  277 (322)
T ss_dssp             CBCCTTTSEEEEE
T ss_pred             EeccCCCceEEEE
Confidence            99    4689873
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>3rb5_A Na/Ca exchange protein; CBD12, calcium binding and regulation, metal binding protein; 2.35A {Drosophila melanogaster} PDB: 3rb7_A 3e9u_A Back     alignment and structure
>2yrl_A KIAA1837 protein; PKD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} Back     alignment and structure
>3ead_A Na/Ca exchange protein; CBD1, calcium regulation, membrane, transmembrane, membrane; 2.25A {Drosophila melanogaster} SCOP: b.1.27.0 Back     alignment and structure
>3gin_A Sodium/calcium exchanger 1; CBD1, CBD2, NCX, calcium binding domain 1, antiport, calcium transport, calmodulin-binding, cell membrane; 2.40A {Canis lupus familiaris} PDB: 2dpk_A* 2fws_A Back     alignment and structure
>2wql_A Major allergen DAU C 1; pathogenesis-related protein, plant defense; HET: P4C; 2.70A {Daucus carota} PDB: 2bk0_A Back     alignment and structure
>3pe9_A Fibronectin(III)-like module; CBHA, beta-sandwich, cellulosome, unknown function; 1.69A {Clostridium thermocellum} Back     alignment and structure
>3us9_A Sodium/calcium exchanger 1; beta-sandwich, calcium binding protein, intracellular, metal protein; 2.68A {Canis lupus familiaris} PDB: 2klt_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.73
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.68
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.66
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.66
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.65
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.62
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.61
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.61
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.59
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.47
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.47
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.3
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.25
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.24
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.21
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.21
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 98.67
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 98.49
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 98.42
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 98.42
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: N-cadherin (neural)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.73  E-value=1e-18  Score=112.93  Aligned_cols=100  Identities=12%  Similarity=0.045  Sum_probs=83.8

Q ss_pred             CCCCCeeEEEEecCCCCCceeEEEEeEECCCCCCCeEEEEEecCCC-------------------CeEEEEEEEEECCCC
Q psy11815          1 MTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNP-------------------ESYFNIDIGSDLTGG   61 (141)
Q Consensus         1 ~f~~~~y~~~V~E~~~~g~~v~~v~a~D~D~~~n~~v~y~i~~~~~-------------------~~y~l~v~a~d~~~~   61 (141)
                      .|.|..|.+.|+|++++|+.|++|.|+|.|.  |+.+.|++.+...                   ..|.|+|.|+|.+.+
T Consensus        12 ~F~~~~Y~~~V~E~~~~Gt~v~~V~a~D~d~--~~~~~y~~~~~~~F~i~~~G~I~~~~~ld~e~~~y~l~V~A~D~g~~   89 (136)
T d1op4a_          12 GFPEDVYSAVLPKDVHEGQPLLNVKFSNCNR--KRKVQYESSEPADFKVDEDGTVYAVRSFPLTAEQAKFLIYAQDKETQ   89 (136)
T ss_dssp             BCCSCEEEECCCCSSCSSCCEEECCCBCCSS--CCCEEEECCCSSEEEEETTTEEEEESCCSCSSSCEEEEEEEEETTTT
T ss_pred             eecCCeEEEEEECCCCCCCEEEEeEeecCCc--cccceeccccceeeeccccEEEEEecccCcccceEEEEEEEEecCCc
Confidence            4999999999999999999999999999996  6778999866442                   679999999999976


Q ss_pred             CCeEEEEEEEEEEeCCCCCCccCCCc-eEEEEecCCCCCceEE
Q psy11815         62 PDQVYLIVYIQVQNVNDNVPMTLDPV-YYAQIVENQSGILPIV  103 (141)
Q Consensus        62 ~~~~~~~v~i~V~d~Nd~~P~f~~~~-~~~~v~e~~~~g~~v~  103 (141)
                      . .+.+.|+|.+.|.|||.|.|.... +.+.++|+...|..++
T Consensus        90 ~-~~~t~V~i~v~d~nd~~p~~~~~~~~~i~~P~~~~~~~~~l  131 (136)
T d1op4a_          90 E-KWQVAVNLSREPTLTEEPMKEPHEIEEIVFPRQLAKHSGAL  131 (136)
T ss_dssp             E-EEEEEEEECCCCCCCCCCSSCCCCSCCCSSCCCCCCCCSCC
T ss_pred             c-eeeeEEEEEEcccCCCCCcccCCCCceEEccCcCCCCCCcc
Confidence            5 466789999999999999997554 4667788877776543
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure