Diaphorina citri psyllid: psy1181


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
KFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKEDSHHH
ccccccccccccccccccccHHHHHHHHHccccEECcccEEEEccccccccccEEEEEcccccCECcccccccEEccccccc
**E*DDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFF*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKEDSHHH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ0MQH7
NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentO75380
NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentP23934

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022904 [BP]respiratory electron transport chainprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0022900, GO:0045333, GO:0008152, GO:0008150, GO:0006091, GO:0055114
GO:0005747 [CC]mitochondrial respiratory chain complex IprobableGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0045271, GO:0032991, GO:0043231, GO:0030964, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0005746, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422
GO:0072358 [BP]cardiovascular system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0072359, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0035264 [BP]multicellular organism growthprobableGO:0044699, GO:0032501, GO:0008150, GO:0040007, GO:0044707
GO:0010259 [BP]multicellular organismal agingprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0006936 [BP]muscle contractionprobableGO:0032501, GO:0044707, GO:0003012, GO:0008150, GO:0044699, GO:0003008
GO:0070584 [BP]mitochondrion morphogenesisprobableGO:0006996, GO:0032502, GO:0009987, GO:0032990, GO:0048869, GO:0071840, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0044699, GO:0008150, GO:0009653, GO:0007005
GO:0006631 [BP]fatty acid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0006082, GO:0009987, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0008137 [MF]NADH dehydrogenase (ubiquinone) activityprobableGO:0003824, GO:0016655, GO:0050136, GO:0016651, GO:0003674, GO:0003954, GO:0016491
GO:0061458 [BP]reproductive system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JVM, chain A
Confidence level:very confident
Coverage over the Query: 29-79
View the alignment between query and template
View the model in PyMOL