Psyllid ID: psy1181
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 82 | ||||||
| 239788117 | 123 | ACYPI000747 [Acyrthosiphon pisum] | 0.975 | 0.650 | 0.775 | 3e-31 | |
| 193688233 | 123 | PREDICTED: probable NADH dehydrogenase [ | 0.975 | 0.650 | 0.775 | 3e-31 | |
| 91083249 | 125 | PREDICTED: similar to CG8680 CG8680-PA [ | 0.975 | 0.64 | 0.787 | 1e-30 | |
| 194856543 | 126 | GG24316 [Drosophila erecta] gi|190660640 | 0.987 | 0.642 | 0.716 | 4e-28 | |
| 357612416 | 211 | hypothetical protein KGM_08437 [Danaus p | 0.975 | 0.379 | 0.712 | 7e-28 | |
| 307187709 | 127 | NADH dehydrogenase [ubiquinone] iron-sul | 0.963 | 0.622 | 0.734 | 8e-28 | |
| 195576690 | 126 | GD22662 [Drosophila simulans] gi|1941902 | 0.987 | 0.642 | 0.703 | 9e-28 | |
| 20129243 | 126 | CG8680 [Drosophila melanogaster] gi|7296 | 0.987 | 0.642 | 0.703 | 1e-27 | |
| 195342670 | 126 | GM18034 [Drosophila sechellia] gi|194132 | 0.987 | 0.642 | 0.703 | 1e-27 | |
| 332375564 | 123 | unknown [Dendroctonus ponderosae] | 0.987 | 0.658 | 0.719 | 1e-27 |
| >gi|239788117|dbj|BAH70753.1| ACYPI000747 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 139 bits (349), Expect = 3e-31, Method: Compositional matrix adjust.
Identities = 62/80 (77%), Positives = 70/80 (87%)
Query: 1 KFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLD 60
K+EKDDYR RF+DK+K VN FAIDLI +VPPKPC ERVV+CDGG GP GHPKVYINLD
Sbjct: 44 KWEKDDYRLARFIDKKKEVNQSFAIDLIKQVPPKPCTERVVYCDGGGGPLGHPKVYINLD 103
Query: 61 KPGNHSCGYCGLRFFKEDSH 80
KPGNH+CGYCGL+F K+DSH
Sbjct: 104 KPGNHACGYCGLQFVKKDSH 123
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|193688233|ref|XP_001945136.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial-like isoform 1 [Acyrthosiphon pisum] gi|328700596|ref|XP_003241318.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|91083249|ref|XP_974018.1| PREDICTED: similar to CG8680 CG8680-PA [Tribolium castaneum] gi|270008233|gb|EFA04681.1| hypothetical protein TcasGA2_TC014412 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|194856543|ref|XP_001968773.1| GG24316 [Drosophila erecta] gi|190660640|gb|EDV57832.1| GG24316 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|357612416|gb|EHJ67985.1| hypothetical protein KGM_08437 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|307187709|gb|EFN72681.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|195576690|ref|XP_002078208.1| GD22662 [Drosophila simulans] gi|194190217|gb|EDX03793.1| GD22662 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|20129243|ref|NP_608909.1| CG8680 [Drosophila melanogaster] gi|7296948|gb|AAF52221.1| CG8680 [Drosophila melanogaster] gi|42415403|gb|AAS15671.1| LP20380p [Drosophila melanogaster] gi|220947668|gb|ACL86377.1| CG8680-PA [synthetic construct] gi|220956968|gb|ACL91027.1| CG8680-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|195342670|ref|XP_002037923.1| GM18034 [Drosophila sechellia] gi|194132773|gb|EDW54341.1| GM18034 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|332375564|gb|AEE62923.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 82 | ||||||
| FB|FBgn0031684 | 126 | CG8680 [Drosophila melanogaste | 0.987 | 0.642 | 0.703 | 1.1e-30 | |
| MGI|MGI:107932 | 116 | Ndufs6 "NADH dehydrogenase (ub | 0.951 | 0.672 | 0.573 | 4.9e-21 | |
| UNIPROTKB|E1BQN0 | 128 | NDUFS6 "Uncharacterized protei | 0.951 | 0.609 | 0.555 | 4.4e-20 | |
| UNIPROTKB|O75380 | 124 | NDUFS6 "NADH dehydrogenase [ub | 0.951 | 0.629 | 0.560 | 4.4e-20 | |
| UNIPROTKB|P23934 | 124 | NDUFS6 "NADH dehydrogenase [ub | 0.951 | 0.629 | 0.555 | 2.5e-19 | |
| UNIPROTKB|F1S031 | 123 | NDUFS6 "Uncharacterized protei | 0.951 | 0.634 | 0.555 | 3.1e-19 | |
| ZFIN|ZDB-GENE-040912-86 | 129 | ndufs6 "NADH dehydrogenase (ub | 0.963 | 0.612 | 0.536 | 4e-19 | |
| RGD|3156 | 116 | Ndufs6 "NADH dehydrogenase (ub | 0.902 | 0.637 | 0.558 | 5.1e-19 | |
| WB|WBGene00009051 | 140 | nduf-6 [Caenorhabditis elegans | 0.939 | 0.55 | 0.55 | 1.1e-18 | |
| UNIPROTKB|A8YXY4 | 152 | NDUFS6 "NADH dehydrogenase [ub | 0.707 | 0.381 | 0.586 | 6.2e-14 |
| FB|FBgn0031684 CG8680 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 338 (124.0 bits), Expect = 1.1e-30, P = 1.1e-30
Identities = 57/81 (70%), Positives = 66/81 (81%)
Query: 2 FEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDK 61
F+K+DYR RFV+ +++VN + I LI EVPPK C ERVV+CDGG GP GHPKVYINLDK
Sbjct: 46 FDKEDYRNARFVNAKRYVNENWGIKLIEEVPPKECTERVVFCDGGDGPLGHPKVYINLDK 105
Query: 62 PGNHSCGYCGLRFFKEDSHHH 82
PGNH CGYCGLRF K+D HHH
Sbjct: 106 PGNHICGYCGLRFVKKDDHHH 126
|
|
| MGI|MGI:107932 Ndufs6 "NADH dehydrogenase (ubiquinone) Fe-S protein 6" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BQN0 NDUFS6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O75380 NDUFS6 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P23934 NDUFS6 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S031 NDUFS6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040912-86 ndufs6 "NADH dehydrogenase (ubiquinone) Fe-S protein 6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|3156 Ndufs6 "NADH dehydrogenase (ubiquinone) Fe-S protein 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00009051 nduf-6 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8YXY4 NDUFS6 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 82 | |||
| pfam10276 | 40 | pfam10276, zf-CHCC, Zinc-finger domain | 4e-13 | |
| COG4391 | 62 | COG4391, COG4391, Uncharacterized protein conserve | 3e-05 |
| >gnl|CDD|204429 pfam10276, zf-CHCC, Zinc-finger domain | Back alignment and domain information |
|---|
Score = 57.3 bits (139), Expect = 4e-13
Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 1/38 (2%)
Query: 38 ERVVWCDGGSGPTGHPKVYINLDK-PGNHSCGYCGLRF 74
R V CDGG GP GHP+VYINLD PG C YCGLRF
Sbjct: 2 GRRVSCDGGGGPLGHPRVYINLDDEPGPVECPYCGLRF 39
|
This is a short zinc-finger domain conserved from fungi to humans. It is Cx8Hx14Cx2C. Length = 40 |
| >gnl|CDD|226826 COG4391, COG4391, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| KOG3456|consensus | 120 | 100.0 | ||
| PF10276 | 40 | zf-CHCC: Zinc-finger domain; InterPro: IPR019401 Z | 99.82 | |
| COG4391 | 62 | Uncharacterized protein conserved in bacteria [Fun | 99.71 | |
| PLN02294 | 174 | cytochrome c oxidase subunit Vb | 98.89 | |
| PF01215 | 136 | COX5B: Cytochrome c oxidase subunit Vb This family | 98.62 | |
| cd00924 | 97 | Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb. | 98.5 | |
| PTZ00043 | 268 | cytochrome c oxidase subunit; Provisional | 98.44 | |
| KOG3352|consensus | 153 | 98.33 | ||
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 96.24 | |
| TIGR02300 | 129 | FYDLN_acid conserved hypothetical protein TIGR0230 | 93.54 | |
| PRK00398 | 46 | rpoP DNA-directed RNA polymerase subunit P; Provis | 93.53 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 90.01 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 89.4 | |
| COG4530 | 129 | Uncharacterized protein conserved in bacteria [Fun | 88.58 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 88.2 | |
| smart00659 | 44 | RPOLCX RNA polymerase subunit CX. present in RNA p | 86.43 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 85.54 | |
| PF13878 | 41 | zf-C2H2_3: zinc-finger of acetyl-transferase ESCO | 85.35 | |
| PF08792 | 33 | A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I | 85.03 | |
| COG1996 | 49 | RPC10 DNA-directed RNA polymerase, subunit RPC10 ( | 83.83 | |
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 83.35 | |
| PF14255 | 52 | Cys_rich_CPXG: Cysteine-rich CPXCG | 81.55 | |
| PF03604 | 32 | DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa | 80.71 |
| >KOG3456|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2e-39 Score=220.79 Aligned_cols=78 Identities=58% Similarity=1.044 Sum_probs=75.8
Q ss_pred CCCcccCCcCcccccccccChhHHHhhhhcCCCeeecCceEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeecC
Q psy1181 1 KFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKED 78 (82)
Q Consensus 1 ~~~~~~~~~~rf~~~~~~~n~~~a~~li~e~P~i~v~~r~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~~ 78 (82)
+||++|||++||++.+|.+|++|||+||+|+||+++++|+|.||||++|||||+||||||+++++.|+|||++|++++
T Consensus 41 ~~D~~Dyr~~rf~~~kk~vn~n~~m~LI~e~Pp~e~d~RVV~CdGg~~aLGHPkvyInLDk~~~~~CgYCGlrf~~dH 118 (120)
T KOG3456|consen 41 VTDQSDYRGNRFVKWKKDVNENSAMELISEVPPIEVDGRVVACDGGTPALGHPKVYINLDKPGPHICGYCGLRFVQDH 118 (120)
T ss_pred ccchHHHhHHHHHhhhhhcCccchhhhhhcCChhhccceEEEecCCCCCCCCCeEEEEcCCCCCcccccchhhhhhhh
Confidence 599999999999999999999999999999999999999999999999999999999999999999999999999843
|
|
| >PF10276 zf-CHCC: Zinc-finger domain; InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG4391 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PLN02294 cytochrome c oxidase subunit Vb | Back alignment and domain information |
|---|
| >PF01215 COX5B: Cytochrome c oxidase subunit Vb This family consists of chains F and S ; InterPro: IPR002124 Cytochrome c oxidase (1 | Back alignment and domain information |
|---|
| >cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb | Back alignment and domain information |
|---|
| >PTZ00043 cytochrome c oxidase subunit; Provisional | Back alignment and domain information |
|---|
| >KOG3352|consensus | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 | Back alignment and domain information |
|---|
| >PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG4530 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >smart00659 RPOLCX RNA polymerase subunit CX | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF13878 zf-C2H2_3: zinc-finger of acetyl-transferase ESCO | Back alignment and domain information |
|---|
| >PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] | Back alignment and domain information |
|---|
| >COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >PF14255 Cys_rich_CPXG: Cysteine-rich CPXCG | Back alignment and domain information |
|---|
| >PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 82 | ||||
| 2jvm_A | 80 | Solution Nmr Structure Of Rhodobacter Sphaeroides P | 7e-04 |
| >pdb|2JVM|A Chain A, Solution Nmr Structure Of Rhodobacter Sphaeroides Protein Rhos4_26430. Northeast Structural Genomics Consortium Target Rhr95 Length = 80 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 82 | |||
| 2jvm_A | 80 | Uncharacterized protein; alpha+beta, structural ge | 1e-20 | |
| 2jrr_A | 67 | Uncharacterized protein; solution structure, SIR90 | 2e-12 | |
| 2jz8_A | 87 | Uncharacterized protein BH09830; zinc binding, str | 2e-07 |
| >2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2} Length = 80 | Back alignment and structure |
|---|
Score = 76.6 bits (188), Expect = 1e-20
Identities = 21/77 (27%), Positives = 31/77 (40%), Gaps = 7/77 (9%)
Query: 13 VDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNH-SCGYCG 71
+ ++ + A I V CDGG G GHP+V++++ CGYC
Sbjct: 1 MRRQPKTRQESARMSIEAPETVVVSTWKVACDGGEGALGHPRVWLSIPHETGFVECGYCD 60
Query: 72 LRFFKEDS------HHH 82
R+ E HHH
Sbjct: 61 RRYIHESFAAAKLEHHH 77
|
| >2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} Length = 67 | Back alignment and structure |
|---|
| >2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str} Length = 87 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| 2jvm_A | 80 | Uncharacterized protein; alpha+beta, structural ge | 99.89 | |
| 2jrr_A | 67 | Uncharacterized protein; solution structure, SIR90 | 99.88 | |
| 2jz8_A | 87 | Uncharacterized protein BH09830; zinc binding, str | 99.88 | |
| 2odx_A | 80 | Cytochrome C oxidase polypeptide IV; all beta-prot | 98.86 | |
| 1v54_F | 98 | VI, cytochrome C oxidase polypeptide VB; oxidoredu | 98.56 | |
| 2y69_F | 129 | Cytochrome C oxidase subunit 5B; electron transpor | 98.44 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 89.06 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 87.87 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 87.35 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 87.09 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 86.99 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 86.92 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.8 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 86.68 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 86.66 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 86.44 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.44 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 86.33 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.29 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.24 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 85.94 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 84.9 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 84.87 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 84.69 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 83.86 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 83.77 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 84.2 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 83.45 | |
| 1gh9_A | 71 | 8.3 kDa protein (gene MTH1184); beta+alpha complex | 83.05 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 82.99 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 82.43 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 82.21 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 81.94 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 81.84 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 81.75 | |
| 1pft_A | 50 | TFIIB, PFTFIIBN; N-terminal domain, transcription | 81.74 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 81.69 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 81.65 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 81.51 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 81.46 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 81.33 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 81.31 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 81.29 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 81.15 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 81.1 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 80.87 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 80.79 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 80.5 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 80.5 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 80.46 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 80.4 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.35 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 80.35 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 80.18 | |
| 3h0g_L | 63 | DNA-directed RNA polymerases I, II, and III subuni | 80.02 |
| >2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
Probab=99.89 E-value=2.1e-24 Score=138.66 Aligned_cols=51 Identities=37% Similarity=0.830 Sum_probs=45.6
Q ss_pred hcCC-CeeecCceEeeCCCCCCCCCCeEEEEc-CCCCeeecCCCCceeeecCC
Q psy1181 29 AEVP-PKPCKERVVWCDGGSGPTGHPKVYINL-DKPGNHSCGYCGLRFFKEDS 79 (82)
Q Consensus 29 ~e~P-~i~v~~r~v~C~Gg~~~lgHP~Vyi~L-~~~~~~~CpYCG~~y~~~~~ 79 (82)
.++| +|+|++++|+|||++++||||+|||+| ++++++.|||||++|+++++
T Consensus 16 ~~apevI~V~~~~V~CdGg~g~LGHPrVyL~ld~~~g~~~CpYCg~~f~l~~~ 68 (80)
T 2jvm_A 16 IEAPETVVVSTWKVACDGGEGALGHPRVWLSIPHETGFVECGYCDRRYIHESF 68 (80)
T ss_dssp CSCCSEEEESCSEEEECCCSTTCCCCCEEEECCTTTCEEECSSSSCEEEEHHH
T ss_pred cCCCCeEEECCcEEEcCCCCCCCCCCEEEEEccCCCCeEECCCCCCEEEecCC
Confidence 3455 589999999999999999999999999 57899999999999999863
|
| >2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str} | Back alignment and structure |
|---|
| >2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1v54_F VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: g.41.5.3 PDB: 1oco_F* 1occ_F* 1ocz_F* 1ocr_F* 1v55_F* 2dyr_F* 2dys_F* 2eij_F* 2eik_F* 2eil_F* 2eim_F* 2ein_F* 2occ_F* 2ybb_Q* 2zxw_F* 3abk_F* 3abl_F* 3abm_F* 3ag1_F* 3ag2_F* ... | Back alignment and structure |
|---|
| >2y69_F Cytochrome C oxidase subunit 5B; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| d1v54f_ | 98 | Cytochrome c oxidase Subunit F {Cow (Bos taurus) [ | 98.77 | |
| d1wjpa2 | 26 | Zinc finger protein 295, ZNF295 {Human (Homo sapie | 96.05 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 91.54 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 90.1 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 89.31 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 89.17 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 89.04 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 88.96 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 85.8 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 85.48 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 85.2 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 85.2 | |
| d1vq0a2 | 57 | HSP33, C-terminal domain {Thermotoga maritima [Tax | 83.39 | |
| d1xjha_ | 62 | HSP33, C-terminal domain {Escherichia coli [TaxId: | 82.83 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 82.12 | |
| d1vzya2 | 57 | HSP33, C-terminal domain {Bacillus subtilis [TaxId | 81.48 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 81.32 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 80.78 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 80.72 | |
| d1pg5b2 | 56 | Aspartate carbamoyltransferase, Regulatory-chain, | 80.72 |
| >d1v54f_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Rubredoxin-like superfamily: Rubredoxin-like family: Cytochrome c oxidase Subunit F domain: Cytochrome c oxidase Subunit F species: Cow (Bos taurus) [TaxId: 9913]
Probab=98.77 E-value=2.5e-09 Score=68.84 Aligned_cols=52 Identities=19% Similarity=0.298 Sum_probs=43.0
Q ss_pred hhcCCCee---ecCceEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeecCCCC
Q psy1181 28 IAEVPPKP---CKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKEDSHH 81 (82)
Q Consensus 28 i~e~P~i~---v~~r~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~~~~~ 81 (82)
+.+-|.+. .+.|+|.|.+ ++.+|..+|+.|.+..+.+|+.||..|+|..++|
T Consensus 42 Tke~P~lVpS~~~~RiVGC~~--~~D~h~v~W~~l~~g~p~RC~eCG~~fkL~~~~~ 96 (98)
T d1v54f_ 42 TKEDPNLVPSITNKRIVGCIC--EEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQL 96 (98)
T ss_dssp CSSSCEEEECSSSEEEEEECC--STTCSCCEEEEEESSSCEECTTTCCEEEEECCCS
T ss_pred CCcCCcEecCCCCceEEeecC--CCCCceeEEEEEeCCCCcccCCCCcEEEEeeccC
Confidence 44555542 3699999997 5789999999999999999999999999997643
|
| >d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vq0a2 g.81.1.1 (A:231-287) HSP33, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xjha_ g.81.1.1 (A:) HSP33, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vzya2 g.81.1.1 (A:234-290) HSP33, C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pg5b2 g.41.7.1 (B:105-160) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|