Psyllid ID: psy1181


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
KFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKEDSHHH
ccccccccccccccccccccHHHHHHHHHHcccEEEcccEEEEccccccccccEEEEEcccccEEEcccccccEEccccccc
ccccccccccEEEcccccccHHHHHHHHHccccEEccccEEEEccccccccccEEEEEccccccccccccccEEEccccccc
kfekddyrpvrfvdkekhvNTQFAIDLiaevppkpckervvwcdggsgptghpkvyinldkpgnhscgycglrffkedshhh
kfekddyrpvrfvdkekhvnTQFAidliaevppkpCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKEDSHHH
KFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKEDSHHH
*********VRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFF*******
**E*DDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCG***********
KFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKEDSHHH
*FEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKE*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKEDSHHH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query82 2.2.26 [Sep-21-2011]
P52503116 NADH dehydrogenase [ubiqu yes N/A 0.951 0.672 0.560 4e-20
Q4R5X8124 NADH dehydrogenase [ubiqu N/A N/A 0.890 0.588 0.594 1e-19
Q0MQH5124 NADH dehydrogenase [ubiqu N/A N/A 0.951 0.629 0.560 1e-19
Q0MQH7124 NADH dehydrogenase [ubiqu yes N/A 0.951 0.629 0.560 2e-19
O75380124 NADH dehydrogenase [ubiqu yes N/A 0.951 0.629 0.560 2e-19
P23934124 NADH dehydrogenase [ubiqu yes N/A 0.951 0.629 0.555 5e-19
Q0MQH6124 NADH dehydrogenase [ubiqu N/A N/A 0.890 0.588 0.581 7e-19
P52504116 NADH dehydrogenase [ubiqu no N/A 0.902 0.637 0.558 9e-19
Q19724140 Probable NADH dehydrogena yes N/A 0.926 0.542 0.545 6e-17
Q5AUI1213 Lactobacillus shifted pro yes N/A 0.695 0.267 0.525 2e-10
>sp|P52503|NDUS6_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Mus musculus GN=Ndufs6 PE=1 SV=2 Back     alignment and function desciption
 Score = 96.7 bits (239), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 57/82 (69%), Gaps = 4/82 (4%)

Query: 2   FEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDK 61
           +++ DYR VRFVD++K VN  FAIDLIA+ P    + R++ CDGG G  GHPKVYINLDK
Sbjct: 38  YDEKDYRRVRFVDRQKEVNENFAIDLIAQQPVNEVEHRIIACDGGGGALGHPKVYINLDK 97

Query: 62  PG-NHSCGYCGLRFFKEDSHHH 82
                +CGYCGL+F     HHH
Sbjct: 98  ETKTGTCGYCGLQF---KQHHH 116




Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Mus musculus (taxid: 10090)
>sp|Q4R5X8|NDUS6_MACFA NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Macaca fascicularis GN=NDUFS6 PE=2 SV=1 Back     alignment and function description
>sp|Q0MQH5|NDUS6_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Pongo pygmaeus GN=NDUFS6 PE=2 SV=1 Back     alignment and function description
>sp|Q0MQH7|NDUS6_PANTR NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Pan troglodytes GN=NDUFS6 PE=2 SV=1 Back     alignment and function description
>sp|O75380|NDUS6_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Homo sapiens GN=NDUFS6 PE=1 SV=1 Back     alignment and function description
>sp|P23934|NDUS6_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Bos taurus GN=NDUFS6 PE=1 SV=2 Back     alignment and function description
>sp|Q0MQH6|NDUS6_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS6 PE=2 SV=1 Back     alignment and function description
>sp|P52504|NDUS6_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Rattus norvegicus GN=Ndufs6 PE=3 SV=1 Back     alignment and function description
>sp|Q19724|NDUS6_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Caenorhabditis elegans GN=nduf-6 PE=3 SV=1 Back     alignment and function description
>sp|Q5AUI1|LBSA_EMENI Lactobacillus shifted protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lbsA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
239788117123 ACYPI000747 [Acyrthosiphon pisum] 0.975 0.650 0.775 3e-31
193688233123 PREDICTED: probable NADH dehydrogenase [ 0.975 0.650 0.775 3e-31
91083249125 PREDICTED: similar to CG8680 CG8680-PA [ 0.975 0.64 0.787 1e-30
194856543126 GG24316 [Drosophila erecta] gi|190660640 0.987 0.642 0.716 4e-28
357612416 211 hypothetical protein KGM_08437 [Danaus p 0.975 0.379 0.712 7e-28
307187709127 NADH dehydrogenase [ubiquinone] iron-sul 0.963 0.622 0.734 8e-28
195576690126 GD22662 [Drosophila simulans] gi|1941902 0.987 0.642 0.703 9e-28
20129243126 CG8680 [Drosophila melanogaster] gi|7296 0.987 0.642 0.703 1e-27
195342670126 GM18034 [Drosophila sechellia] gi|194132 0.987 0.642 0.703 1e-27
332375564123 unknown [Dendroctonus ponderosae] 0.987 0.658 0.719 1e-27
>gi|239788117|dbj|BAH70753.1| ACYPI000747 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 62/80 (77%), Positives = 70/80 (87%)

Query: 1   KFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLD 60
           K+EKDDYR  RF+DK+K VN  FAIDLI +VPPKPC ERVV+CDGG GP GHPKVYINLD
Sbjct: 44  KWEKDDYRLARFIDKKKEVNQSFAIDLIKQVPPKPCTERVVYCDGGGGPLGHPKVYINLD 103

Query: 61  KPGNHSCGYCGLRFFKEDSH 80
           KPGNH+CGYCGL+F K+DSH
Sbjct: 104 KPGNHACGYCGLQFVKKDSH 123




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193688233|ref|XP_001945136.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial-like isoform 1 [Acyrthosiphon pisum] gi|328700596|ref|XP_003241318.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91083249|ref|XP_974018.1| PREDICTED: similar to CG8680 CG8680-PA [Tribolium castaneum] gi|270008233|gb|EFA04681.1| hypothetical protein TcasGA2_TC014412 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|194856543|ref|XP_001968773.1| GG24316 [Drosophila erecta] gi|190660640|gb|EDV57832.1| GG24316 [Drosophila erecta] Back     alignment and taxonomy information
>gi|357612416|gb|EHJ67985.1| hypothetical protein KGM_08437 [Danaus plexippus] Back     alignment and taxonomy information
>gi|307187709|gb|EFN72681.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|195576690|ref|XP_002078208.1| GD22662 [Drosophila simulans] gi|194190217|gb|EDX03793.1| GD22662 [Drosophila simulans] Back     alignment and taxonomy information
>gi|20129243|ref|NP_608909.1| CG8680 [Drosophila melanogaster] gi|7296948|gb|AAF52221.1| CG8680 [Drosophila melanogaster] gi|42415403|gb|AAS15671.1| LP20380p [Drosophila melanogaster] gi|220947668|gb|ACL86377.1| CG8680-PA [synthetic construct] gi|220956968|gb|ACL91027.1| CG8680-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195342670|ref|XP_002037923.1| GM18034 [Drosophila sechellia] gi|194132773|gb|EDW54341.1| GM18034 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|332375564|gb|AEE62923.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
FB|FBgn0031684126 CG8680 [Drosophila melanogaste 0.987 0.642 0.703 1.1e-30
MGI|MGI:107932116 Ndufs6 "NADH dehydrogenase (ub 0.951 0.672 0.573 4.9e-21
UNIPROTKB|E1BQN0128 NDUFS6 "Uncharacterized protei 0.951 0.609 0.555 4.4e-20
UNIPROTKB|O75380124 NDUFS6 "NADH dehydrogenase [ub 0.951 0.629 0.560 4.4e-20
UNIPROTKB|P23934124 NDUFS6 "NADH dehydrogenase [ub 0.951 0.629 0.555 2.5e-19
UNIPROTKB|F1S031123 NDUFS6 "Uncharacterized protei 0.951 0.634 0.555 3.1e-19
ZFIN|ZDB-GENE-040912-86129 ndufs6 "NADH dehydrogenase (ub 0.963 0.612 0.536 4e-19
RGD|3156116 Ndufs6 "NADH dehydrogenase (ub 0.902 0.637 0.558 5.1e-19
WB|WBGene00009051140 nduf-6 [Caenorhabditis elegans 0.939 0.55 0.55 1.1e-18
UNIPROTKB|A8YXY4152 NDUFS6 "NADH dehydrogenase [ub 0.707 0.381 0.586 6.2e-14
FB|FBgn0031684 CG8680 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 338 (124.0 bits), Expect = 1.1e-30, P = 1.1e-30
 Identities = 57/81 (70%), Positives = 66/81 (81%)

Query:     2 FEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDK 61
             F+K+DYR  RFV+ +++VN  + I LI EVPPK C ERVV+CDGG GP GHPKVYINLDK
Sbjct:    46 FDKEDYRNARFVNAKRYVNENWGIKLIEEVPPKECTERVVFCDGGDGPLGHPKVYINLDK 105

Query:    62 PGNHSCGYCGLRFFKEDSHHH 82
             PGNH CGYCGLRF K+D HHH
Sbjct:   106 PGNHICGYCGLRFVKKDDHHH 126




GO:0008137 "NADH dehydrogenase (ubiquinone) activity" evidence=ISS
GO:0005747 "mitochondrial respiratory chain complex I" evidence=ISS
MGI|MGI:107932 Ndufs6 "NADH dehydrogenase (ubiquinone) Fe-S protein 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQN0 NDUFS6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O75380 NDUFS6 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P23934 NDUFS6 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S031 NDUFS6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-86 ndufs6 "NADH dehydrogenase (ubiquinone) Fe-S protein 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|3156 Ndufs6 "NADH dehydrogenase (ubiquinone) Fe-S protein 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00009051 nduf-6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|A8YXY4 NDUFS6 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5AUI1LBSA_EMENINo assigned EC number0.52540.69510.2676yesN/A
Q19724NDUS6_CAEELNo assigned EC number0.54540.92680.5428yesN/A
Q0MQH7NDUS6_PANTRNo assigned EC number0.56090.95120.6290yesN/A
O75380NDUS6_HUMANNo assigned EC number0.56090.95120.6290yesN/A
P23934NDUS6_BOVINNo assigned EC number0.55550.95120.6290yesN/A
P52503NDUS6_MOUSENo assigned EC number0.56090.95120.6724yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
pfam1027640 pfam10276, zf-CHCC, Zinc-finger domain 4e-13
COG439162 COG4391, COG4391, Uncharacterized protein conserve 3e-05
>gnl|CDD|204429 pfam10276, zf-CHCC, Zinc-finger domain Back     alignment and domain information
 Score = 57.3 bits (139), Expect = 4e-13
 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 1/38 (2%)

Query: 38 ERVVWCDGGSGPTGHPKVYINLDK-PGNHSCGYCGLRF 74
           R V CDGG GP GHP+VYINLD  PG   C YCGLRF
Sbjct: 2  GRRVSCDGGGGPLGHPRVYINLDDEPGPVECPYCGLRF 39


This is a short zinc-finger domain conserved from fungi to humans. It is Cx8Hx14Cx2C. Length = 40

>gnl|CDD|226826 COG4391, COG4391, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 82
KOG3456|consensus120 100.0
PF1027640 zf-CHCC: Zinc-finger domain; InterPro: IPR019401 Z 99.82
COG439162 Uncharacterized protein conserved in bacteria [Fun 99.71
PLN02294174 cytochrome c oxidase subunit Vb 98.89
PF01215136 COX5B: Cytochrome c oxidase subunit Vb This family 98.62
cd0092497 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb. 98.5
PTZ00043268 cytochrome c oxidase subunit; Provisional 98.44
KOG3352|consensus153 98.33
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 96.24
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 93.54
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 93.53
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 90.01
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 89.4
COG4530129 Uncharacterized protein conserved in bacteria [Fun 88.58
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 88.2
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 86.43
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 85.54
PF1387841 zf-C2H2_3: zinc-finger of acetyl-transferase ESCO 85.35
PF0879233 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I 85.03
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 83.83
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 83.35
PF1425552 Cys_rich_CPXG: Cysteine-rich CPXCG 81.55
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 80.71
>KOG3456|consensus Back     alignment and domain information
Probab=100.00  E-value=2e-39  Score=220.79  Aligned_cols=78  Identities=58%  Similarity=1.044  Sum_probs=75.8

Q ss_pred             CCCcccCCcCcccccccccChhHHHhhhhcCCCeeecCceEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeecC
Q psy1181           1 KFEKDDYRPVRFVDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKED   78 (82)
Q Consensus         1 ~~~~~~~~~~rf~~~~~~~n~~~a~~li~e~P~i~v~~r~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~~   78 (82)
                      +||++|||++||++.+|.+|++|||+||+|+||+++++|+|.||||++|||||+||||||+++++.|+|||++|++++
T Consensus        41 ~~D~~Dyr~~rf~~~kk~vn~n~~m~LI~e~Pp~e~d~RVV~CdGg~~aLGHPkvyInLDk~~~~~CgYCGlrf~~dH  118 (120)
T KOG3456|consen   41 VTDQSDYRGNRFVKWKKDVNENSAMELISEVPPIEVDGRVVACDGGTPALGHPKVYINLDKPGPHICGYCGLRFVQDH  118 (120)
T ss_pred             ccchHHHhHHHHHhhhhhcCccchhhhhhcCChhhccceEEEecCCCCCCCCCeEEEEcCCCCCcccccchhhhhhhh
Confidence            599999999999999999999999999999999999999999999999999999999999999999999999999843



>PF10276 zf-CHCC: Zinc-finger domain; InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02294 cytochrome c oxidase subunit Vb Back     alignment and domain information
>PF01215 COX5B: Cytochrome c oxidase subunit Vb This family consists of chains F and S ; InterPro: IPR002124 Cytochrome c oxidase (1 Back     alignment and domain information
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb Back     alignment and domain information
>PTZ00043 cytochrome c oxidase subunit; Provisional Back     alignment and domain information
>KOG3352|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13878 zf-C2H2_3: zinc-finger of acetyl-transferase ESCO Back     alignment and domain information
>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF14255 Cys_rich_CPXG: Cysteine-rich CPXCG Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
2jvm_A80 Solution Nmr Structure Of Rhodobacter Sphaeroides P 7e-04
>pdb|2JVM|A Chain A, Solution Nmr Structure Of Rhodobacter Sphaeroides Protein Rhos4_26430. Northeast Structural Genomics Consortium Target Rhr95 Length = 80 Back     alignment and structure

Iteration: 1

Score = 38.9 bits (89), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Query: 41 VWCDGGSGPTGHPKVYINL-DKPGNHSCGYCGLRFFKED 78 V CDGG G GHP+V++++ + G CGYC R+ E Sbjct: 29 VACDGGEGALGHPRVWLSIPHETGFVECGYCDRRYIHES 67

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
2jvm_A80 Uncharacterized protein; alpha+beta, structural ge 1e-20
2jrr_A67 Uncharacterized protein; solution structure, SIR90 2e-12
2jz8_A87 Uncharacterized protein BH09830; zinc binding, str 2e-07
>2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2} Length = 80 Back     alignment and structure
 Score = 76.6 bits (188), Expect = 1e-20
 Identities = 21/77 (27%), Positives = 31/77 (40%), Gaps = 7/77 (9%)

Query: 13 VDKEKHVNTQFAIDLIAEVPPKPCKERVVWCDGGSGPTGHPKVYINLDKPGNH-SCGYCG 71
          + ++     + A   I            V CDGG G  GHP+V++++        CGYC 
Sbjct: 1  MRRQPKTRQESARMSIEAPETVVVSTWKVACDGGEGALGHPRVWLSIPHETGFVECGYCD 60

Query: 72 LRFFKEDS------HHH 82
           R+  E        HHH
Sbjct: 61 RRYIHESFAAAKLEHHH 77


>2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} Length = 67 Back     alignment and structure
>2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str} Length = 87 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
2jvm_A80 Uncharacterized protein; alpha+beta, structural ge 99.89
2jrr_A67 Uncharacterized protein; solution structure, SIR90 99.88
2jz8_A87 Uncharacterized protein BH09830; zinc binding, str 99.88
2odx_A80 Cytochrome C oxidase polypeptide IV; all beta-prot 98.86
1v54_F98 VI, cytochrome C oxidase polypeptide VB; oxidoredu 98.56
2y69_F129 Cytochrome C oxidase subunit 5B; electron transpor 98.44
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 89.06
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 87.87
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 87.35
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 87.09
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 86.99
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 86.92
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.8
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 86.68
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 86.66
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 86.44
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.44
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 86.33
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.29
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.24
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 85.94
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 84.9
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.87
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 84.69
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 83.86
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.77
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 84.2
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.45
1gh9_A71 8.3 kDa protein (gene MTH1184); beta+alpha complex 83.05
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 82.99
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 82.43
1vd4_A62 Transcription initiation factor IIE, alpha subunit 82.21
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 81.94
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 81.84
1ard_A29 Yeast transcription factor ADR1; transcription reg 81.75
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 81.74
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 81.69
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 81.65
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 81.51
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 81.46
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 81.33
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 81.31
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 81.29
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 81.15
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 81.1
1paa_A30 Yeast transcription factor ADR1; transcription reg 80.87
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 80.79
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 80.5
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.5
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 80.46
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 80.4
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 80.35
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 80.35
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 80.18
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 80.02
>2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2} Back     alignment and structure
Probab=99.89  E-value=2.1e-24  Score=138.66  Aligned_cols=51  Identities=37%  Similarity=0.830  Sum_probs=45.6

Q ss_pred             hcCC-CeeecCceEeeCCCCCCCCCCeEEEEc-CCCCeeecCCCCceeeecCC
Q psy1181          29 AEVP-PKPCKERVVWCDGGSGPTGHPKVYINL-DKPGNHSCGYCGLRFFKEDS   79 (82)
Q Consensus        29 ~e~P-~i~v~~r~v~C~Gg~~~lgHP~Vyi~L-~~~~~~~CpYCG~~y~~~~~   79 (82)
                      .++| +|+|++++|+|||++++||||+|||+| ++++++.|||||++|+++++
T Consensus        16 ~~apevI~V~~~~V~CdGg~g~LGHPrVyL~ld~~~g~~~CpYCg~~f~l~~~   68 (80)
T 2jvm_A           16 IEAPETVVVSTWKVACDGGEGALGHPRVWLSIPHETGFVECGYCDRRYIHESF   68 (80)
T ss_dssp             CSCCSEEEESCSEEEECCCSTTCCCCCEEEECCTTTCEEECSSSSCEEEEHHH
T ss_pred             cCCCCeEEECCcEEEcCCCCCCCCCCEEEEEccCCCCeEECCCCCCEEEecCC
Confidence            3455 589999999999999999999999999 57899999999999999863



>2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} Back     alignment and structure
>2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str} Back     alignment and structure
>2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_F VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: g.41.5.3 PDB: 1oco_F* 1occ_F* 1ocz_F* 1ocr_F* 1v55_F* 2dyr_F* 2dys_F* 2eij_F* 2eik_F* 2eil_F* 2eim_F* 2ein_F* 2occ_F* 2ybb_Q* 2zxw_F* 3abk_F* 3abl_F* 3abm_F* 3ag1_F* 3ag2_F* ... Back     alignment and structure
>2y69_F Cytochrome C oxidase subunit 5B; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
d1v54f_98 Cytochrome c oxidase Subunit F {Cow (Bos taurus) [ 98.77
d1wjpa226 Zinc finger protein 295, ZNF295 {Human (Homo sapie 96.05
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 91.54
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 90.1
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 89.31
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 89.17
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 89.04
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 88.96
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 85.8
d2cota238 Zinc finger and SCAN domain-containing protein 16, 85.48
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 85.2
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 85.2
d1vq0a257 HSP33, C-terminal domain {Thermotoga maritima [Tax 83.39
d1xjha_62 HSP33, C-terminal domain {Escherichia coli [TaxId: 82.83
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 82.12
d1vzya257 HSP33, C-terminal domain {Bacillus subtilis [TaxId 81.48
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 81.32
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 80.78
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 80.72
d1pg5b256 Aspartate carbamoyltransferase, Regulatory-chain, 80.72
>d1v54f_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Rubredoxin-like
family: Cytochrome c oxidase Subunit F
domain: Cytochrome c oxidase Subunit F
species: Cow (Bos taurus) [TaxId: 9913]
Probab=98.77  E-value=2.5e-09  Score=68.84  Aligned_cols=52  Identities=19%  Similarity=0.298  Sum_probs=43.0

Q ss_pred             hhcCCCee---ecCceEeeCCCCCCCCCCeEEEEcCCCCeeecCCCCceeeecCCCC
Q psy1181          28 IAEVPPKP---CKERVVWCDGGSGPTGHPKVYINLDKPGNHSCGYCGLRFFKEDSHH   81 (82)
Q Consensus        28 i~e~P~i~---v~~r~v~C~Gg~~~lgHP~Vyi~L~~~~~~~CpYCG~~y~~~~~~~   81 (82)
                      +.+-|.+.   .+.|+|.|.+  ++.+|..+|+.|.+..+.+|+.||..|+|..++|
T Consensus        42 Tke~P~lVpS~~~~RiVGC~~--~~D~h~v~W~~l~~g~p~RC~eCG~~fkL~~~~~   96 (98)
T d1v54f_          42 TKEDPNLVPSITNKRIVGCIC--EEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQL   96 (98)
T ss_dssp             CSSSCEEEECSSSEEEEEECC--STTCSCCEEEEEESSSCEECTTTCCEEEEECCCS
T ss_pred             CCcCCcEecCCCCceEEeecC--CCCCceeEEEEEeCCCCcccCCCCcEEEEeeccC
Confidence            44555542   3699999997  5789999999999999999999999999997643



>d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vq0a2 g.81.1.1 (A:231-287) HSP33, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xjha_ g.81.1.1 (A:) HSP33, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vzya2 g.81.1.1 (A:234-290) HSP33, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pg5b2 g.41.7.1 (B:105-160) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure