Diaphorina citri psyllid: psy11834

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MNKITEAQIIETQSSQFIQPYSVKFVQEALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQVLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAGQYVWRY
cccccEEEEEECccccCEEEEEEEEEEccEEEcEEEEECcEEEEECcEEEEEEEEEEEEEEEEEEEcccccccEEEEEEcccEEEEccccccccCEEEEECcccccccEEEEEEcccccccccHHHHHHHHHHcccccccccccEEEccEEEccccccccEEEEEEEEEEcccccccccccccccEEEEEEcHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccc
**KITEAQIIETQSSQFIQPYSVKFVQEALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQVLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAGQYVW**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKITEAQIIETQSSQFIQPYSVKFVQEALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQVLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAGQYVWRY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uridine diphosphate glucose pyrophosphatase Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and ADP-ribose to ribose 5-phosphate and AMP. The physiological substrate is probably UDP-glucose. Poor activity on other substrates such as ADP-glucose, CDP-glucose, GDP-glucose and GDP-mannose.confidentO95848
Uridine diphosphate glucose pyrophosphatase Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and ADP-ribose to ribose 5-phosphate and AMP. The physiological substrate is probably UDP-glucose. Poor activity on other substrates such as ADP-glucose, CDP-glucose, GDP-glucose and GDP-mannose.confidentQ05B60
Uridine diphosphate glucose pyrophosphatase Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and ADP-ribose to ribose 5-phosphate and AMP. The physiological substrate is probably UDP-glucose. Poor activity on other substrates such as ADP-glucose, CDP-glucose, GDP-glucose and GDP-mannose.confidentQ9D142

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016818 [MF]hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydridesprobableGO:0016787, GO:0003674, GO:0016817, GO:0003824

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3Q91, chain A
Confidence level:very confident
Coverage over the Query: 45-65,79-90,107-226
View the alignment between query and template
View the model in PyMOL