Psyllid ID: psy11834


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MNKITEAQIIETQSSQFIQPYSVKFVQEALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQVLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAGQYVWRY
cccccEEEEEEEccccEEEEEEEEEEEccEEEcEEEEEEcEEEEEEcEEEEEEEEEEEEEEEEEEEcccccccEEEEEEcccEEEEccccccccEEEEEEEcccccccEEEEEEcccccccccHHHHHHHHHHcccccccccccEEEccEEEccccccccEEEEEEEEEEcccccccccccccccEEEEEEcHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccc
cccccEEEEEcccccccEEEEEEEEEEcccEEEEEccccHHHHEccccEEEEEEEccccEEEEEEEccccccEEEEEEEEccccHcccccccccccccccccccccccEEEEEEcccccccccHHHHHHHHHHHHHcccccHHHHHHHHEEEccccccccEEEEEEEEEccHHcccccccccccEEEEEEEcHHHHHHHHHcccccccHHHHHHHHHHHHcccccEEEEc
MNKITEAQIIEtqssqfiqpySVKFVQEALIKEnqychpqflitqhKDYYIVMNKITEAQIIEtrssqfiqpySVKFVQVLLSVYINsipeedrtgsidvtkypaelgVTLEFCAGIVDKNKSLAEIAREEVLEecgydvpveKLEKIQTFrsgvgsagdrqtLFFVEVTDdmkvnsgggvdeELIEVVEMGLEEAREYLaqdevrspsgfLFAMHWFLAAKAGQYVWRY
mnkiteaqiietqssqfiqpySVKFVQEALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQVLLSVYINSipeedrtgsidVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQtfrsgvgsagdrQTLFFVEVTddmkvnsgggvdeeLIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAGQYVWRY
MNKITEAQIIETQSSQFIQPYSVKFVQEALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQVLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAGQYVWRY
**************SQFIQPYSVKFVQEALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQVLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAGQYVW**
**KITEAQIIETQSSQFIQPYSVKFVQEALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQVLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKV****GVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAG******
MNKITEAQIIETQSSQFIQPYSVKFVQEALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQVLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAGQYVWRY
**KITEAQIIETQSSQFIQPYSVKFVQEALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQVLLSVYINSIPE*DRTGSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAGQYVWRY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKITEAQIIETQSSQFIQPYSVKFVQEALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQVLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAGQYVWRY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query230 2.2.26 [Sep-21-2011]
O95848222 Uridine diphosphate gluco yes N/A 0.9 0.932 0.305 1e-22
Q05B60222 Uridine diphosphate gluco yes N/A 0.926 0.959 0.296 9e-22
Q9D142222 Uridine diphosphate gluco yes N/A 0.9 0.932 0.283 1e-19
A7ML00191 GDP-mannose pyrophosphata yes N/A 0.473 0.570 0.357 3e-08
A6TC90198 GDP-mannose pyrophosphata yes N/A 0.443 0.515 0.364 8e-08
Q6D8X4193 GDP-mannose pyrophosphata yes N/A 0.478 0.569 0.330 1e-07
A8ADC6191 GDP-mannose pyrophosphata yes N/A 0.456 0.549 0.333 3e-07
Q32DA4191 GDP-mannose pyrophosphata yes N/A 0.456 0.549 0.324 4e-07
Q8XBE7191 GDP-mannose pyrophosphata N/A N/A 0.456 0.549 0.324 4e-07
Q83K58191 GDP-mannose pyrophosphata yes N/A 0.456 0.549 0.324 4e-07
>sp|O95848|NUD14_HUMAN Uridine diphosphate glucose pyrophosphatase OS=Homo sapiens GN=NUDT14 PE=1 SV=2 Back     alignment and function desciption
 Score =  106 bits (265), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/226 (30%), Positives = 113/226 (50%), Gaps = 19/226 (8%)

Query: 1   MNKITEAQIIETQSSQFIQPYSVKFVQEALIKENQYCHPQFLITQHKDYYIVMNKITEAQ 60
           M +I  A +    +S +++P ++ + Q    K        F+ T      ++ N    + 
Sbjct: 1   MERIEGASVGRCAASPYLRPLTLHYRQNGAQKSWD-----FMKTHDSVTVLLFNSSRRSL 55

Query: 61  II--ETRSSQFIQPYSVKFVQVLLSVYINSIPEEDRTGSIDV-TKYPAELGVTLEFCAGI 117
           ++  + R + +      +F   L +V        D+ G  ++    P   GVT+E CAG+
Sbjct: 56  VLVKQFRPAVYAGEVERRFPGSLAAV--------DQDGPRELQPALPGSAGVTVELCAGL 107

Query: 118 VDK-NKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVN 176
           VD+   SL E+A +E  EECGY +    L ++ T+ SGVG  G RQT+F+ EVTD  +  
Sbjct: 108 VDQPGLSLEEVACKEAWEECGYHLAPSDLRRVATYWSGVGLTGSRQTMFYTEVTDAQRSG 167

Query: 177 SGGGVDE--ELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLA 220
            GGG+ E  ELIEVV + LE A+ +    ++    G +F + WFL+
Sbjct: 168 PGGGLVEEGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLS 213




Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and ADP-ribose to ribose 5-phosphate and AMP. The physiological substrate is probably UDP-glucose. Poor activity on other substrates such as ADP-glucose, CDP-glucose, GDP-glucose and GDP-mannose.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: 4EC: 5
>sp|Q05B60|NUD14_BOVIN Uridine diphosphate glucose pyrophosphatase OS=Bos taurus GN=NUDT14 PE=2 SV=1 Back     alignment and function description
>sp|Q9D142|NUD14_MOUSE Uridine diphosphate glucose pyrophosphatase OS=Mus musculus GN=Nudt14 PE=2 SV=1 Back     alignment and function description
>sp|A7ML00|NUDK_CROS8 GDP-mannose pyrophosphatase NudK OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nudK PE=3 SV=1 Back     alignment and function description
>sp|A6TC90|NUDK_KLEP7 GDP-mannose pyrophosphatase NudK OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=nudK PE=3 SV=1 Back     alignment and function description
>sp|Q6D8X4|NUDK_ERWCT GDP-mannose pyrophosphatase NudK OS=Erwinia carotovora subsp. atroseptica (strain SCRI 1043 / ATCC BAA-672) GN=nudK PE=3 SV=1 Back     alignment and function description
>sp|A8ADC6|NUDK_CITK8 GDP-mannose pyrophosphatase NudK OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nudK PE=3 SV=1 Back     alignment and function description
>sp|Q32DA4|NUDK_SHIDS GDP-mannose pyrophosphatase NudK OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nudK PE=3 SV=1 Back     alignment and function description
>sp|Q8XBE7|NUDK_ECO57 GDP-mannose pyrophosphatase NudK OS=Escherichia coli O157:H7 GN=nudK PE=3 SV=1 Back     alignment and function description
>sp|Q83K58|NUDK_SHIFL GDP-mannose pyrophosphatase NudK OS=Shigella flexneri GN=nudK PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
91081183205 PREDICTED: similar to UDP-glucose pyroph 0.886 0.995 0.466 2e-50
321466727211 hypothetical protein DAPPUDRAFT_213302 [ 0.904 0.985 0.484 5e-50
91085093210 PREDICTED: similar to AGAP004158-PA [Tri 0.608 0.666 0.585 1e-42
389609917211 UDP-glucose pyrophosphatase [Papilio xut 0.9 0.981 0.416 6e-40
195053610211 GH21306 [Drosophila grimshawi] gi|193895 0.886 0.966 0.411 5e-39
357623953211 hypothetical protein KGM_22654 [Danaus p 0.9 0.981 0.407 1e-38
195574324 438 GD18086 [Drosophila simulans] gi|1942010 0.834 0.438 0.413 1e-37
320543347212 CG42813 [Drosophila melanogaster] gi|318 0.834 0.905 0.413 1e-37
326633289232 RH24252p [Drosophila melanogaster] 0.834 0.827 0.413 1e-37
195503835 404 GE10580 [Drosophila yakuba] gi|194184921 0.834 0.475 0.413 1e-37
>gi|91081183|ref|XP_975594.1| PREDICTED: similar to UDP-glucose pyrophosphatase [Tribolium castaneum] gi|270005275|gb|EFA01723.1| hypothetical protein TcasGA2_TC007303 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 104/223 (46%), Positives = 145/223 (65%), Gaps = 19/223 (8%)

Query: 1   MNKITEAQIIETQSSQFIQPYSVKFVQEALIKENQYCHPQFLITQHKDYYIVMNKITEAQ 60
           MNKI++  +   + S +++P ++ FVQ      N       L+  H    I+++   +  
Sbjct: 1   MNKISDVVLKPLEKSIYVKPQTMHFVQ------NGRKRTWDLLDVHDSVAILLHNTRKQT 54

Query: 61  IIETRSSQFIQPYSVKFVQVLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDK 120
           +I  +  QF  P           VY  SIPEEDR G+IDV KYPAELG+TLE CAG+VDK
Sbjct: 55  LIFVK--QFRPP-----------VYFGSIPEEDRKGTIDVNKYPAELGITLEMCAGLVDK 101

Query: 121 NKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGG 180
           +K L EIA+EE+LEECGYDVP+  L K+ ++RSGVG+ G  QT ++ EVTDDMKV+ GGG
Sbjct: 102 DKPLVEIAKEEILEECGYDVPLSSLVKVGSYRSGVGTLGSLQTTYYCEVTDDMKVSQGGG 161

Query: 181 VDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKA 223
           V +E+I+VVEM + E ++Y+ QD++ SP  FLFA++WFL  K 
Sbjct: 162 VGDEIIDVVEMTVPEVKKYITQDKIPSPPSFLFAVYWFLLNKV 204




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321466727|gb|EFX77721.1| hypothetical protein DAPPUDRAFT_213302 [Daphnia pulex] Back     alignment and taxonomy information
>gi|91085093|ref|XP_967751.1| PREDICTED: similar to AGAP004158-PA [Tribolium castaneum] gi|270008500|gb|EFA04948.1| hypothetical protein TcasGA2_TC015015 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|389609917|dbj|BAM18570.1| UDP-glucose pyrophosphatase [Papilio xuthus] Back     alignment and taxonomy information
>gi|195053610|ref|XP_001993719.1| GH21306 [Drosophila grimshawi] gi|193895589|gb|EDV94455.1| GH21306 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|357623953|gb|EHJ74903.1| hypothetical protein KGM_22654 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195574324|ref|XP_002105139.1| GD18086 [Drosophila simulans] gi|194201066|gb|EDX14642.1| GD18086 [Drosophila simulans] Back     alignment and taxonomy information
>gi|320543347|ref|NP_733202.2| CG42813 [Drosophila melanogaster] gi|318068877|gb|AAF56679.3| CG42813 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|326633289|gb|ADZ99412.1| RH24252p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195503835|ref|XP_002098820.1| GE10580 [Drosophila yakuba] gi|194184921|gb|EDW98532.1| GE10580 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
FB|FBgn0261995404 CG42813 [Drosophila melanogast 0.613 0.349 0.538 1.1e-38
ZFIN|ZDB-GENE-041014-254242 nudt14 "nudix (nucleoside diph 0.960 0.913 0.356 7.7e-32
UNIPROTKB|Q5ZJ67227 NUDT14 "Uncharacterized protei 0.5 0.506 0.559 1.5e-28
UNIPROTKB|F1PRK5186 NUDT14 "Uncharacterized protei 0.573 0.709 0.411 1.6e-22
UNIPROTKB|O95848222 NUDT14 "Uridine diphosphate gl 0.591 0.612 0.414 2.1e-22
UNIPROTKB|Q05B60222 NUDT14 "Uridine diphosphate gl 0.573 0.594 0.397 7e-22
RGD|1310583222 Nudt14 "nudix (nucleoside diph 0.508 0.527 0.425 9e-22
UNIPROTKB|F1S972176 NUDT14 "Uncharacterized protei 0.573 0.75 0.389 4.9e-21
UNIPROTKB|Q5HW20198 CJE0497 "NUDIX domain protein" 0.504 0.585 0.45 1.7e-20
TIGR_CMR|CJE_0497198 CJE_0497 "NUDIX domain protein 0.504 0.585 0.45 1.7e-20
FB|FBgn0261995 CG42813 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 392 (143.0 bits), Expect = 1.1e-38, Sum P(2) = 1.1e-38
 Identities = 77/143 (53%), Positives = 101/143 (70%)

Query:    83 SVYINSIPEEDRT-GSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVP 141
             +VY   I     T   +D+ ++P  +GVTLE CAGIVDKNKS  EIAREEV+EECGYDVP
Sbjct:   257 AVYHGIISSAKGTFDEVDLKEFPPAIGVTLELCAGIVDKNKSWVEIAREEVVEECGYDVP 316

Query:   142 VEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLA 201
             VE++E++  +RSGVGS+G +QT+++ EVTD  K   GGGVD+E+IEVVE+ LEEA+  + 
Sbjct:   317 VERIEEVMVYRSGVGSSGAKQTMYYCEVTDADKATGGGGVDDEIIEVVELSLEEAKRMIQ 376

Query:   202 QDEVR-SPSGFLFAMHWFLAAKA 223
             Q  V  SP   L  + WF A +A
Sbjct:   377 QGAVNNSPPSCLMGLMWFFANRA 399


GO:0046872 "metal ion binding" evidence=IEA
GO:0016818 "hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides" evidence=IEA
ZFIN|ZDB-GENE-041014-254 nudt14 "nudix (nucleoside diphosphate linked moiety X)-type motif 14" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJ67 NUDT14 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRK5 NUDT14 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O95848 NUDT14 "Uridine diphosphate glucose pyrophosphatase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q05B60 NUDT14 "Uridine diphosphate glucose pyrophosphatase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1310583 Nudt14 "nudix (nucleoside diphosphate linked moiety X)-type motif 14" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S972 NUDT14 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5HW20 CJE0497 "NUDIX domain protein" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0497 CJE_0497 "NUDIX domain protein" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q05B60NUD14_BOVIN3, ., 6, ., 1, ., 4, 50.29640.92600.9594yesN/A
Q9D142NUD14_MOUSE3, ., 6, ., 1, ., 4, 50.28310.90.9324yesN/A
O95848NUD14_HUMAN3, ., 6, ., 1, ., 4, 50.30530.90.9324yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.10.691
3rd Layer3.6.1.45LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
cd03424137 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase 2e-24
TIGR00052185 TIGR00052, TIGR00052, nudix-type nucleoside diphos 2e-21
pfam00293133 pfam00293, NUDIX, NUDIX domain 1e-11
PRK15009191 PRK15009, PRK15009, GDP-mannose pyrophosphatase Nu 9e-11
cd02883123 cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup 4e-05
cd03673131 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate 8e-04
>gnl|CDD|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
 Score = 93.7 bits (234), Expect = 2e-24
 Identities = 38/117 (32%), Positives = 55/117 (47%), Gaps = 5/117 (4%)

Query: 103 YPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQ 162
            P   G  LE  AG++D  +   E AR E+ EE GY+     LEK+ +F    G + +R 
Sbjct: 24  PPVG-GWLLELPAGLIDPGEDPEEAARRELEEETGYE--AGDLEKLGSFYPSPGFSDERI 80

Query: 163 TLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFL 219
            LF  E     +   G   + E IEVV + L+EA E LA  E+   +  +  + W  
Sbjct: 81  HLFLAEDLSPGEE--GLLDEGEDIEVVLVPLDEALELLADGEIIDDATLIALLLWLA 135


Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer. Length = 137

>gnl|CDD|129162 TIGR00052, TIGR00052, nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain Back     alignment and domain information
>gnl|CDD|184971 PRK15009, PRK15009, GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
>gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 230
PRK15009191 GDP-mannose pyrophosphatase NudK; Provisional 100.0
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 99.98
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 99.97
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 99.97
KOG4432|consensus405 99.96
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 99.9
KOG4432|consensus 405 99.9
PLN03143291 nudix hydrolase; Provisional 99.89
KOG3041|consensus225 99.86
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 99.82
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 99.78
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 99.77
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 99.76
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 99.76
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 99.75
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 99.75
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 99.74
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 99.74
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 99.74
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 99.73
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 99.73
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 99.72
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 99.72
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 99.72
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 99.72
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 99.72
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 99.71
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 99.71
PRK15393180 NUDIX hydrolase YfcD; Provisional 99.71
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 99.71
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 99.7
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 99.7
PRK00714156 RNA pyrophosphohydrolase; Reviewed 99.7
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 99.69
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 99.68
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 99.68
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 99.68
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 99.67
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 99.67
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 99.67
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 99.67
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 99.66
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 99.66
PRK00241256 nudC NADH pyrophosphatase; Reviewed 99.65
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 99.64
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 99.64
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 99.64
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 99.64
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 99.64
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 99.64
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 99.63
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 99.63
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 99.63
PRK10707190 putative NUDIX hydrolase; Provisional 99.63
PRK15472141 nucleoside triphosphatase NudI; Provisional 99.63
PLN02325144 nudix hydrolase 99.63
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 99.62
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 99.62
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 99.62
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 99.61
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 99.6
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 99.6
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 99.57
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 99.56
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 99.56
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 99.56
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 99.55
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 99.54
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 99.52
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 99.52
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 99.52
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 99.49
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 99.48
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 99.48
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 99.48
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 99.43
PLN02791 770 Nudix hydrolase homolog 99.4
KOG3084|consensus345 99.38
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 99.34
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 99.34
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 99.31
PRK08999 312 hypothetical protein; Provisional 99.29
PLN02709222 nudix hydrolase 99.29
PLN02552247 isopentenyl-diphosphate delta-isomerase 99.27
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 99.18
KOG2839|consensus145 99.11
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 98.96
KOG3069|consensus246 98.78
PLN02839372 nudix hydrolase 98.5
COG1443185 Idi Isopentenyldiphosphate isomerase [Lipid metabo 98.46
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 98.32
KOG0648|consensus295 98.21
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replicatio 98.1
PF14815114 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 96.96
KOG0142|consensus225 96.59
KOG4195|consensus275 96.08
KOG2937|consensus 348 95.88
COG4112203 Predicted phosphoesterase (MutT family) [General f 92.8
PF13869188 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 89.97
KOG1689|consensus221 82.74
KOG4313|consensus306 80.41
>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.2e-32  Score=230.66  Aligned_cols=178  Identities=21%  Similarity=0.409  Sum_probs=151.4

Q ss_pred             EeEEEEeeecCeeeEEEEEEe---ecCeE--eecccccceeeEeecCeEEEEEEEcCCCEEEEEEecCCcCCccccceec
Q psy11834          6 EAQIIETQSSQFIQPYSVKFV---QEALI--KENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQV   80 (230)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~---~~g~~--~~~~~~~~~~~~~~~~~v~vl~~~~~~~~vll~r~~~~~~~~~~~~~q~   80 (230)
                      ++...+++.++|+++++.+++   +||..  ..|      +++.++++|+|++++.++++++|+|             ||
T Consensus         6 ~~~~~~~~~~~~~~v~~~~~~~~~pdG~~~~~~r------~vv~~~~~v~Vl~~~~~~~~vvLvr-------------Qy   66 (191)
T PRK15009          6 TLIKDKILSDNYFTLHNITYDLTRKDGEVIRHKR------EVYDRGNGATILLYNAKKKTVVLIR-------------QF   66 (191)
T ss_pred             EEEEEEEEeCCeEEEEEEEEEEECCCCCccceEE------EEEEECCEEEEEEEECCCCEEEEEE-------------cc
Confidence            355667789999999997754   68874  345      8999999999999987678999999             99


Q ss_pred             ccceeccCCcccccCCccccccCCCCCCcEEEeeeeecCCCCCHHHHHHHHHHhhhCCccCCCceEEEEEEEcCCCccCe
Q psy11834         81 LLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGD  160 (230)
Q Consensus        81 r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~elPgG~VE~GEs~~eAA~REl~EETGl~v~~~~l~~l~~~~~~~~~s~~  160 (230)
                      |++++....                ..+++||+|||.+|+| ++++||+|||+||||+.+  ..+.+++.+++++|.+++
T Consensus        67 R~~v~~~~~----------------~~~~~lElPAG~vd~~-~p~~aA~REL~EETGy~a--~~~~~l~~~~~spG~s~e  127 (191)
T PRK15009         67 RVATWVNGN----------------ESGQLIETCAGLLDND-EPEVCIRKEAIEETGYEV--GEVRKLFELYMSPGGVTE  127 (191)
T ss_pred             cccccccCC----------------CCceEEEEeccccCCC-CHHHHHHHHHHHhhCCcc--ceEEEeeEEEcCCcccCc
Confidence            999864321                1579999999999976 799999999999999999  999999999999999999


Q ss_pred             EEEEEEEEEcCcccccCCCCCCCceEEEEEEcHHHHHHHhhcCCCCChHHHHHHHHHHHHhh
Q psy11834        161 RQTLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAK  222 (230)
Q Consensus       161 ~~~~y~a~~~~~~~~~~~~~~~~E~~~v~wv~~eE~~~~~~~~~~~~~~~~~~a~~~~~~~~  222 (230)
                      .+|+|+|+.......+.+..+++|.++++|+|++++.+++.+|++.+ +.++.|++|++.++
T Consensus       128 ~~~lf~a~~~~~~~~~~~~~de~E~iev~~~~~~e~~~~i~~G~i~d-a~ti~al~~~~~~~  188 (191)
T PRK15009        128 LIHFFIAEYSDSQRANAGGGVEDEDIEVLELPFSQALEMIKTGEIRD-GKTVLLLNYLQTSH  188 (191)
T ss_pred             EEEEEEEEECchhcccCCCCCCCceEEEEEEcHHHHHHHHHcCCCCc-HHHHHHHHHHHHhc
Confidence            99999999753333344445788999999999999999999999997 78899999988763



>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>KOG4432|consensus Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>KOG4432|consensus Back     alignment and domain information
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
>KOG3041|consensus Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>KOG3084|consensus Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>PLN02552 isopentenyl-diphosphate delta-isomerase Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>KOG2839|consensus Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>KOG3069|consensus Back     alignment and domain information
>PLN02839 nudix hydrolase Back     alignment and domain information
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>KOG0648|consensus Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A Back     alignment and domain information
>KOG0142|consensus Back     alignment and domain information
>KOG4195|consensus Back     alignment and domain information
>KOG2937|consensus Back     alignment and domain information
>COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] Back     alignment and domain information
>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A Back     alignment and domain information
>KOG1689|consensus Back     alignment and domain information
>KOG4313|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
3q91_A218 Crystal Structure Of Human Uridine Diphosphate Gluc 2e-22
3o6z_A191 Structure Of The D152a E.Coli Gdp-Mannose Hydrolase 2e-08
3o52_A191 Structure Of The E.Coli Gdp-Mannose Hydrolase (Yffh 3e-08
1viu_A203 Crystal Structure Of Putative Adp Ribose Pyrophosph 4e-08
3o61_A191 Structure Of The E100a E.Coli Gdp-Mannose Hydrolase 1e-07
1g0s_A209 The Crystal Structure Of The E.Coli Adp-Ribose Pyro 8e-04
>pdb|3Q91|A Chain A, Crystal Structure Of Human Uridine Diphosphate Glucose Pyrophosphatase (Nudt14) Length = 218 Back     alignment and structure

Iteration: 1

Score = 102 bits (255), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 53/120 (44%), Positives = 74/120 (61%), Gaps = 3/120 (2%) Query: 104 PAELGVTLEFCAGIVDK-NKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQ 162 P GVT+E CAG+VD+ SL E+A +E EECGY + L ++ T+ SGVG G RQ Sbjct: 90 PGSAGVTVELCAGLVDQPGLSLEEVACKEAWEECGYHLAPSDLRRVATYWSGVGLTGSRQ 149 Query: 163 TLFFVEVTDDMKVNSGGGVDE--ELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLA 220 T+F+ EVTD + GGG+ E ELIEVV + LE A+ + ++ G +F + WFL+ Sbjct: 150 TMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLS 209
>pdb|3O6Z|A Chain A, Structure Of The D152a E.Coli Gdp-Mannose Hydrolase (Yffh) In Complex With Mg++ Length = 191 Back     alignment and structure
>pdb|3O52|A Chain A, Structure Of The E.Coli Gdp-Mannose Hydrolase (Yffh) In Complex With Tartrate Length = 191 Back     alignment and structure
>pdb|1VIU|A Chain A, Crystal Structure Of Putative Adp Ribose Pyrophosphatase Length = 203 Back     alignment and structure
>pdb|3O61|A Chain A, Structure Of The E100a E.Coli Gdp-Mannose Hydrolase (Yffh) In Complex With Gdp-Mannose And Mg++ Length = 191 Back     alignment and structure
>pdb|1G0S|A Chain A, The Crystal Structure Of The E.Coli Adp-Ribose Pyrophosphatase Length = 209 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 1e-32
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 2e-20
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 3e-15
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 3e-13
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 3e-12
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 1e-10
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 8e-10
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 2e-09
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 4e-07
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 2e-06
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 4e-06
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 5e-06
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1xsa_A153 BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, 3e-04
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 6e-04
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Length = 218 Back     alignment and structure
 Score =  116 bits (292), Expect = 1e-32
 Identities = 58/160 (36%), Positives = 82/160 (51%), Gaps = 5/160 (3%)

Query: 68  QFIQPYSVKFVQVLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDK-NKSLAE 126
           QF     V   +V      +    +           P   GVT+E CAG+VD+   SL E
Sbjct: 56  QFRPA--VYAGEVERRFPGSLAAVDQDGPRELQPALPGSAGVTVELCAGLVDQPGLSLEE 113

Query: 127 IAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGGVDE--E 184
           +A +E  EECGY +    L ++ T+ SGVG  G RQT+F+ EVTD  +   GGG+ E  E
Sbjct: 114 VACKEAWEECGYHLAPSDLRRVATYWSGVGLTGSRQTMFYTEVTDAQRSGPGGGLVEEGE 173

Query: 185 LIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAG 224
           LIEVV + LE A+ +    ++    G +F + WFL+  A 
Sbjct: 174 LIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQVAP 213


>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Length = 191 Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Length = 209 Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Length = 212 Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182 Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Length = 145 Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198 Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Length = 170 Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Length = 207 Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 99.98
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 99.97
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 99.96
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 99.96
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 99.95
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 99.95
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 99.94
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 99.94
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 99.92
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 99.81
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 99.77
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 99.77
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.75
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 99.75
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 99.74
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 99.74
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 99.73
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 99.73
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 99.72
3grn_A153 MUTT related protein; structural genomics, hydrola 99.72
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 99.72
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 99.71
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 99.71
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 99.7
3son_A149 Hypothetical nudix hydrolase; structural genomics, 99.7
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 99.7
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 99.7
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 99.69
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 99.69
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.69
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 99.69
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 99.68
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 99.68
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 99.68
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 99.68
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 99.67
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 99.67
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 99.67
3fcm_A197 Hydrolase, nudix family; protein structure initiat 99.67
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 99.66
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 99.66
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 99.65
3exq_A161 Nudix family hydrolase; protein structure initiati 99.65
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 99.64
3f6a_A159 Hydrolase, nudix family; protein structure initiat 99.64
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 99.63
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 99.63
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 99.63
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 99.63
2b06_A155 MUTT/nudix family protein; structural genomics, P 99.61
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 99.6
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 99.6
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 99.59
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 99.57
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 99.57
3dup_A300 MUTT/nudix family protein; nudix superfamily hydro 99.56
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 99.55
2fml_A273 MUTT/nudix family protein; structural genomics, PS 99.54
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 99.53
3f13_A163 Putative nudix hydrolase family member; structural 99.53
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 99.53
2fb1_A226 Conserved hypothetical protein; structural genomic 99.53
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 99.52
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 99.51
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 99.51
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 99.51
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 99.51
3qsj_A232 Nudix hydrolase; structural genomics, PSI-biology, 99.5
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 99.5
3gz5_A240 MUTT/nudix family protein; DNA binding protein, nu 99.48
3e57_A211 Uncharacterized protein TM1382; structural genomic 99.44
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 99.39
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 99.25
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 99.19
3bho_A208 Cleavage and polyadenylation specificity factor su 98.7
3kvh_A214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 98.7
3rh7_A321 Hypothetical oxidoreductase; FMN-binding split bar 98.68
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
Probab=99.98  E-value=1.1e-31  Score=230.12  Aligned_cols=190  Identities=30%  Similarity=0.523  Sum_probs=127.5

Q ss_pred             eeEEEEEEe-ecCeEeecccccceeeEeecCeEEEEEEEcCCCEEEEEEecCCcCCccccceecccceeccCCcc-----
Q psy11834         18 IQPYSVKFV-QEALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQVLLSVYINSIPE-----   91 (230)
Q Consensus        18 ~~~~~~~~~-~~g~~~~~~~~~~~~~~~~~~~v~vl~~~~~~~~vll~r~~~~~~~~~~~~~q~r~~~~~~~~~~-----   91 (230)
                      +...++++. +||....|      +++.++++|+|++++.+++++||+|             |||++.+.+.++.     
T Consensus        13 ~~~~~~~~~~~~G~~~~~------e~v~~~~aV~vl~~~~~~~~vlLvr-------------Q~R~~~~~~~~~~~~~~~   73 (218)
T 3q91_A           13 LGTENLYFQSMNGAQKSW------DFMKTHDSVTVLLFNSSRRSLVLVK-------------QFRPAVYAGEVERRFPGS   73 (218)
T ss_dssp             ----------------------------CCCEEEEEEEEGGGTEEEEEE-------------EECHHHHHHHTC------
T ss_pred             cceeEEEEECCCCCEEEE------EEEEcCCeEEEEEEECCCCEEEEEE-------------cccccccccccccccccc
Confidence            556777877 79998899      9999999999999997789999999             9999986433211     


Q ss_pred             ----cccCCccccccCCCCCCcEEEeeeeecCC-CCCHHHHHHHHHHhhhCCccCCCceEEEEEEEcCCCccCeEEEEEE
Q psy11834         92 ----EDRTGSIDVTKYPAELGVTLEFCAGIVDK-NKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFF  166 (230)
Q Consensus        92 ----~~~~~~~~~~~~~~~~~~~~elPgG~VE~-GEs~~eAA~REl~EETGl~v~~~~l~~l~~~~~~~~~s~~~~~~y~  166 (230)
                          ..+.-++.-.+||.+.+++|+||||++|+ ||++.+||+||++||||+.+.+..+..++.++++++.++..+++|+
T Consensus        74 ~~~~~~~~~~~~~~~~~~~~~~~welPgG~ve~~gEs~~eaA~REl~EEtGl~~~~~~l~~l~~~~~~~g~~~~~~~~f~  153 (218)
T 3q91_A           74 LAAVDQDGPRELQPALPGSAGVTVELCAGLVDQPGLSLEEVACKEAWEECGYHLAPSDLRRVATYWSGVGLTGSRQTMFY  153 (218)
T ss_dssp             -------------------CCEEEECEEEECCSSSCCHHHHHHHHHHHHHCBCCCGGGCEEEEEEEEC---CCEEEEEEE
T ss_pred             ccccccccccccccccccCCCeEEECCcceeCCCCCCHHHHHHHHHHHHhCCccccCceEEEEEEecCCCccceEEEEEE
Confidence                01111233446888889999999999999 9999999999999999999876789999999998888899999999


Q ss_pred             EEEcCcccccC--CCCCCCceEEEEEEcHHHHHHHhhcCCCCChHHHHHHHHHHHHhhcCCc
Q psy11834        167 VEVTDDMKVNS--GGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAGQY  226 (230)
Q Consensus       167 a~~~~~~~~~~--~~~~~~E~~~v~wv~~eE~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~  226 (230)
                      +.+.....+..  ...+++|++++.|++++++.+++.+|++..+.+.++|++||+++|.+++
T Consensus       154 a~~~~~~~~~~~~~~~d~~E~~ev~wv~l~el~~~i~~g~i~~~~~~l~al~W~~~~~~~~~  215 (218)
T 3q91_A          154 TEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQVAPNL  215 (218)
T ss_dssp             EEECGGGBCC---------CCEEEEEEEGGGHHHHHHCTTSCBBHHHHHHHHHHHHHTGGGC
T ss_pred             EEECCcccccCCCCCCCCCcEEEEEEEEHHHHHHHHHcCCCCccHHHHHHHHHHHhcccccc
Confidence            99765433222  2346889999999999999999999999888888899999999998764



>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 230
d1g0sa_209 d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escheri 1e-10
d1viua_189 d.113.1.1 (A:) ADP-ribose pyrophosphatase homologu 1e-10
d1v8ya_158 d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus 3e-08
d1sjya_158 d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc 1e-07
d1vcda1126 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t 8e-06
d1vhza_186 d.113.1.1 (A:) ADP compounds hydrolase NudE {Esche 3e-05
d1mqea_202 d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobac 2e-04
d1xsba_153 d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas 2e-04
d2azwa1147 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E 6e-04
d2a6ta2151 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c 0.002
d2o5fa1162 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {D 0.004
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 209 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: ADP-ribose pyrophosphatase
species: Escherichia coli [TaxId: 562]
 Score = 56.6 bits (136), Expect = 1e-10
 Identities = 27/118 (22%), Positives = 57/118 (48%), Gaps = 4/118 (3%)

Query: 108 GVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFV 167
              LE  AG++++ +S+ ++AR E +EE G  V  ++ + + +F +  G   +R ++   
Sbjct: 89  PWLLEMVAGMIEEGESVEDVARREAIEEAGLIV--KRTKPVLSFLASPGGTSERSSIMVG 146

Query: 168 EVTDDMKVNSGGGVDE-ELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAG 224
           EV         G  DE E I V  +  E+A +++ + ++ + +  + A+ W       
Sbjct: 147 EVDATTASGIHGLADENEDIRVHVVSREQAYQWVEEGKIDN-AASVIALQWLQLHHQA 203


>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Length = 189 Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Length = 158 Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 Back     information, alignment and structure
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Length = 186 Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 202 Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 100.0
d1viua_189 ADP-ribose pyrophosphatase homologue YffH {Escheri 100.0
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 100.0
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 99.98
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 99.96
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 99.84
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 99.8
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 99.78
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 99.76
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 99.75
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 99.75
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 99.72
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 99.71
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 99.71
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 99.69
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 99.69
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.68
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.67
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 99.67
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.67
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 99.64
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 99.64
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 99.62
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 99.61
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 99.54
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 99.5
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 99.22
d1q33a_292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 99.03
d1u20a1196 U8 snorna-binding protein x29 {African clawed frog 99.02
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 98.87
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: ADP-ribose pyrophosphatase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=7.2e-34  Score=240.49  Aligned_cols=184  Identities=16%  Similarity=0.260  Sum_probs=149.7

Q ss_pred             cceEeEEEEeeecCeeeEEEEEEee---cCeEeecccccceeeEeecCeEEEEEEEcCCCEEEEEEecCCcCCcccccee
Q psy11834          3 KITEAQIIETQSSQFIQPYSVKFVQ---EALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQ   79 (230)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~---~g~~~~~~~~~~~~~~~~~~~v~vl~~~~~~~~vll~r~~~~~~~~~~~~~q   79 (230)
                      +++.++...++++ ||++.+++++.   ||.   +.....|+++.++++|+|++++..+++++|+|             |
T Consensus        15 dv~il~~~~vy~G-~~~v~~~~~~~~~~dG~---~s~~~~rev~~~~~~v~vl~~~~~~~~vlLvr-------------Q   77 (209)
T d1g0sa_          15 DVEIIARETLYRG-FFSLDLYRFRHRLFNGQ---MSHEVRREIFERGHAAVLLPFDPVRDEVVLIE-------------Q   77 (209)
T ss_dssp             GEEEEEEEEEEES-SSEEEEEEEEEBCTTSC---BCCCEEEEEEECCCEEEEEEEETTTTEEEEEE-------------E
T ss_pred             ceEEEEEEEEEcC-eEEEEEEEEEEECCCCC---cccEEEEEEEecCCEEEEEEEEecCCeEEEEE-------------E
Confidence            3566677777776 88887776653   554   32233458999999999999997789999999             9


Q ss_pred             cccceeccCCcccccCCccccccCCCCCCcEEEeeeeecCCCCCHHHHHHHHHHhhhCCccCCCceEEEEEEEcCCCccC
Q psy11834         80 VLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAG  159 (230)
Q Consensus        80 ~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~elPgG~VE~GEs~~eAA~REl~EETGl~v~~~~l~~l~~~~~~~~~s~  159 (230)
                      ||++++....                 .+|.||+|||.+|+|||+++||+|||+|||||.+  ..+..++.++++++.++
T Consensus        78 ~R~~~~~~~~-----------------~~~~lElPAG~id~gE~p~~aA~REL~EEtG~~~--~~l~~l~~~~~spg~~~  138 (209)
T d1g0sa_          78 IRIAAYDTSE-----------------TPWLLEMVAGMIEEGESVEDVARREAIEEAGLIV--KRTKPVLSFLASPGGTS  138 (209)
T ss_dssp             ECGGGGGGSS-----------------CSEEEECEEEECCTTCCHHHHHHHHHHHHHCCCC--CCEEEEEEEESCTTTBC
T ss_pred             EeccccccCC-----------------CceEEeeceeecCCCcCHHHHHHHHHHhhhcccc--cceeeccccccCCcccC
Confidence            9999864321                 5789999999999999999999999999999999  89999999999999999


Q ss_pred             eEEEEEEEEEcCcccccC-CCCCCCceEEEEEEcHHHHHHHhhcCCCCChHHHHHHHHHHHHhhc
Q psy11834        160 DRQTLFFVEVTDDMKVNS-GGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKA  223 (230)
Q Consensus       160 ~~~~~y~a~~~~~~~~~~-~~~~~~E~~~v~wv~~eE~~~~~~~~~~~~~~~~~~a~~~~~~~~~  223 (230)
                      +.+++|+|.++.....+. +..+++|.++++|++++|+.+++.+|+|.+ +.|++|++|+..+++
T Consensus       139 e~~~~f~a~~~~~~~~~~~~~~de~E~iev~~v~~~e~~~~i~~g~I~d-a~ti~al~~~~l~~~  202 (209)
T d1g0sa_         139 ERSSIMVGEVDATTASGIHGLADENEDIRVHVVSREQAYQWVEEGKIDN-AASVIALQWLQLHHQ  202 (209)
T ss_dssp             CEEEEEEEECCGGGCC--------CCSCEEEEEEHHHHHHHHHTTSSCB-HHHHHHHHHHHHHHH
T ss_pred             CceEEEEEEEecccccCCCCCCCCCceeEEEEEeHHHHHHHHHcCCCCc-HHHHHHHHHHHHhHH
Confidence            999999998654332221 123678899999999999999999999997 778999999988764



>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure