Psyllid ID: psy11834
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 230 | ||||||
| 91081183 | 205 | PREDICTED: similar to UDP-glucose pyroph | 0.886 | 0.995 | 0.466 | 2e-50 | |
| 321466727 | 211 | hypothetical protein DAPPUDRAFT_213302 [ | 0.904 | 0.985 | 0.484 | 5e-50 | |
| 91085093 | 210 | PREDICTED: similar to AGAP004158-PA [Tri | 0.608 | 0.666 | 0.585 | 1e-42 | |
| 389609917 | 211 | UDP-glucose pyrophosphatase [Papilio xut | 0.9 | 0.981 | 0.416 | 6e-40 | |
| 195053610 | 211 | GH21306 [Drosophila grimshawi] gi|193895 | 0.886 | 0.966 | 0.411 | 5e-39 | |
| 357623953 | 211 | hypothetical protein KGM_22654 [Danaus p | 0.9 | 0.981 | 0.407 | 1e-38 | |
| 195574324 | 438 | GD18086 [Drosophila simulans] gi|1942010 | 0.834 | 0.438 | 0.413 | 1e-37 | |
| 320543347 | 212 | CG42813 [Drosophila melanogaster] gi|318 | 0.834 | 0.905 | 0.413 | 1e-37 | |
| 326633289 | 232 | RH24252p [Drosophila melanogaster] | 0.834 | 0.827 | 0.413 | 1e-37 | |
| 195503835 | 404 | GE10580 [Drosophila yakuba] gi|194184921 | 0.834 | 0.475 | 0.413 | 1e-37 |
| >gi|91081183|ref|XP_975594.1| PREDICTED: similar to UDP-glucose pyrophosphatase [Tribolium castaneum] gi|270005275|gb|EFA01723.1| hypothetical protein TcasGA2_TC007303 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 204 bits (520), Expect = 2e-50, Method: Compositional matrix adjust.
Identities = 104/223 (46%), Positives = 145/223 (65%), Gaps = 19/223 (8%)
Query: 1 MNKITEAQIIETQSSQFIQPYSVKFVQEALIKENQYCHPQFLITQHKDYYIVMNKITEAQ 60
MNKI++ + + S +++P ++ FVQ N L+ H I+++ +
Sbjct: 1 MNKISDVVLKPLEKSIYVKPQTMHFVQ------NGRKRTWDLLDVHDSVAILLHNTRKQT 54
Query: 61 IIETRSSQFIQPYSVKFVQVLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDK 120
+I + QF P VY SIPEEDR G+IDV KYPAELG+TLE CAG+VDK
Sbjct: 55 LIFVK--QFRPP-----------VYFGSIPEEDRKGTIDVNKYPAELGITLEMCAGLVDK 101
Query: 121 NKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGG 180
+K L EIA+EE+LEECGYDVP+ L K+ ++RSGVG+ G QT ++ EVTDDMKV+ GGG
Sbjct: 102 DKPLVEIAKEEILEECGYDVPLSSLVKVGSYRSGVGTLGSLQTTYYCEVTDDMKVSQGGG 161
Query: 181 VDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKA 223
V +E+I+VVEM + E ++Y+ QD++ SP FLFA++WFL K
Sbjct: 162 VGDEIIDVVEMTVPEVKKYITQDKIPSPPSFLFAVYWFLLNKV 204
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321466727|gb|EFX77721.1| hypothetical protein DAPPUDRAFT_213302 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|91085093|ref|XP_967751.1| PREDICTED: similar to AGAP004158-PA [Tribolium castaneum] gi|270008500|gb|EFA04948.1| hypothetical protein TcasGA2_TC015015 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|389609917|dbj|BAM18570.1| UDP-glucose pyrophosphatase [Papilio xuthus] | Back alignment and taxonomy information |
|---|
| >gi|195053610|ref|XP_001993719.1| GH21306 [Drosophila grimshawi] gi|193895589|gb|EDV94455.1| GH21306 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|357623953|gb|EHJ74903.1| hypothetical protein KGM_22654 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|195574324|ref|XP_002105139.1| GD18086 [Drosophila simulans] gi|194201066|gb|EDX14642.1| GD18086 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|320543347|ref|NP_733202.2| CG42813 [Drosophila melanogaster] gi|318068877|gb|AAF56679.3| CG42813 [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|326633289|gb|ADZ99412.1| RH24252p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195503835|ref|XP_002098820.1| GE10580 [Drosophila yakuba] gi|194184921|gb|EDW98532.1| GE10580 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 230 | ||||||
| FB|FBgn0261995 | 404 | CG42813 [Drosophila melanogast | 0.613 | 0.349 | 0.538 | 1.1e-38 | |
| ZFIN|ZDB-GENE-041014-254 | 242 | nudt14 "nudix (nucleoside diph | 0.960 | 0.913 | 0.356 | 7.7e-32 | |
| UNIPROTKB|Q5ZJ67 | 227 | NUDT14 "Uncharacterized protei | 0.5 | 0.506 | 0.559 | 1.5e-28 | |
| UNIPROTKB|F1PRK5 | 186 | NUDT14 "Uncharacterized protei | 0.573 | 0.709 | 0.411 | 1.6e-22 | |
| UNIPROTKB|O95848 | 222 | NUDT14 "Uridine diphosphate gl | 0.591 | 0.612 | 0.414 | 2.1e-22 | |
| UNIPROTKB|Q05B60 | 222 | NUDT14 "Uridine diphosphate gl | 0.573 | 0.594 | 0.397 | 7e-22 | |
| RGD|1310583 | 222 | Nudt14 "nudix (nucleoside diph | 0.508 | 0.527 | 0.425 | 9e-22 | |
| UNIPROTKB|F1S972 | 176 | NUDT14 "Uncharacterized protei | 0.573 | 0.75 | 0.389 | 4.9e-21 | |
| UNIPROTKB|Q5HW20 | 198 | CJE0497 "NUDIX domain protein" | 0.504 | 0.585 | 0.45 | 1.7e-20 | |
| TIGR_CMR|CJE_0497 | 198 | CJE_0497 "NUDIX domain protein | 0.504 | 0.585 | 0.45 | 1.7e-20 |
| FB|FBgn0261995 CG42813 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 392 (143.0 bits), Expect = 1.1e-38, Sum P(2) = 1.1e-38
Identities = 77/143 (53%), Positives = 101/143 (70%)
Query: 83 SVYINSIPEEDRT-GSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVP 141
+VY I T +D+ ++P +GVTLE CAGIVDKNKS EIAREEV+EECGYDVP
Sbjct: 257 AVYHGIISSAKGTFDEVDLKEFPPAIGVTLELCAGIVDKNKSWVEIAREEVVEECGYDVP 316
Query: 142 VEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLA 201
VE++E++ +RSGVGS+G +QT+++ EVTD K GGGVD+E+IEVVE+ LEEA+ +
Sbjct: 317 VERIEEVMVYRSGVGSSGAKQTMYYCEVTDADKATGGGGVDDEIIEVVELSLEEAKRMIQ 376
Query: 202 QDEVR-SPSGFLFAMHWFLAAKA 223
Q V SP L + WF A +A
Sbjct: 377 QGAVNNSPPSCLMGLMWFFANRA 399
|
|
| ZFIN|ZDB-GENE-041014-254 nudt14 "nudix (nucleoside diphosphate linked moiety X)-type motif 14" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZJ67 NUDT14 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PRK5 NUDT14 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O95848 NUDT14 "Uridine diphosphate glucose pyrophosphatase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q05B60 NUDT14 "Uridine diphosphate glucose pyrophosphatase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1310583 Nudt14 "nudix (nucleoside diphosphate linked moiety X)-type motif 14" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S972 NUDT14 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5HW20 CJE0497 "NUDIX domain protein" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CJE_0497 CJE_0497 "NUDIX domain protein" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 230 | |||
| cd03424 | 137 | cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase | 2e-24 | |
| TIGR00052 | 185 | TIGR00052, TIGR00052, nudix-type nucleoside diphos | 2e-21 | |
| pfam00293 | 133 | pfam00293, NUDIX, NUDIX domain | 1e-11 | |
| PRK15009 | 191 | PRK15009, PRK15009, GDP-mannose pyrophosphatase Nu | 9e-11 | |
| cd02883 | 123 | cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup | 4e-05 | |
| cd03673 | 131 | cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate | 8e-04 |
| >gnl|CDD|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
Score = 93.7 bits (234), Expect = 2e-24
Identities = 38/117 (32%), Positives = 55/117 (47%), Gaps = 5/117 (4%)
Query: 103 YPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQ 162
P G LE AG++D + E AR E+ EE GY+ LEK+ +F G + +R
Sbjct: 24 PPVG-GWLLELPAGLIDPGEDPEEAARRELEEETGYE--AGDLEKLGSFYPSPGFSDERI 80
Query: 163 TLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFL 219
LF E + G + E IEVV + L+EA E LA E+ + + + W
Sbjct: 81 HLFLAEDLSPGEE--GLLDEGEDIEVVLVPLDEALELLADGEIIDDATLIALLLWLA 135
|
Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer. Length = 137 |
| >gnl|CDD|129162 TIGR00052, TIGR00052, nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain | Back alignment and domain information |
|---|
| >gnl|CDD|184971 PRK15009, PRK15009, GDP-mannose pyrophosphatase NudK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 230 | |||
| PRK15009 | 191 | GDP-mannose pyrophosphatase NudK; Provisional | 100.0 | |
| PRK10729 | 202 | nudF ADP-ribose pyrophosphatase NudF; Provisional | 99.98 | |
| TIGR00052 | 185 | nudix-type nucleoside diphosphatase, YffH/AdpP fam | 99.97 | |
| PRK11762 | 185 | nudE adenosine nucleotide hydrolase NudE; Provisio | 99.97 | |
| KOG4432|consensus | 405 | 99.96 | ||
| cd03424 | 137 | ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) | 99.9 | |
| KOG4432|consensus | 405 | 99.9 | ||
| PLN03143 | 291 | nudix hydrolase; Provisional | 99.89 | |
| KOG3041|consensus | 225 | 99.86 | ||
| cd04700 | 142 | DR1025_like DR1025 from Deinococcus radiodurans, a | 99.82 | |
| cd03672 | 145 | Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt | 99.78 | |
| cd04683 | 120 | Nudix_Hydrolase_24 Members of the Nudix hydrolase | 99.77 | |
| PF00293 | 134 | NUDIX: NUDIX domain; InterPro: IPR000086 The gener | 99.76 | |
| cd04697 | 126 | Nudix_Hydrolase_38 Members of the Nudix hydrolase | 99.76 | |
| cd03676 | 180 | Nudix_hydrolase_3 Members of the Nudix hydrolase s | 99.75 | |
| PRK09438 | 148 | nudB dihydroneopterin triphosphate pyrophosphatase | 99.75 | |
| cd04679 | 125 | Nudix_Hydrolase_20 Members of the Nudix hydrolase | 99.74 | |
| cd03675 | 134 | Nudix_Hydrolase_2 Contains a crystal structure of | 99.74 | |
| cd04680 | 120 | Nudix_Hydrolase_21 Members of the Nudix hydrolase | 99.74 | |
| cd04691 | 117 | Nudix_Hydrolase_32 Members of the Nudix hydrolase | 99.73 | |
| TIGR02705 | 156 | nudix_YtkD nucleoside triphosphatase YtkD. The fun | 99.73 | |
| cd04693 | 127 | Nudix_Hydrolase_34 Members of the Nudix hydrolase | 99.72 | |
| cd03426 | 157 | CoAse Coenzyme A pyrophosphatase (CoAse), a member | 99.72 | |
| cd04692 | 144 | Nudix_Hydrolase_33 Members of the Nudix hydrolase | 99.72 | |
| cd04673 | 122 | Nudix_Hydrolase_15 Members of the Nudix hydrolase | 99.72 | |
| cd04687 | 128 | Nudix_Hydrolase_28 Members of the Nudix hydrolase | 99.72 | |
| cd03671 | 147 | Ap4A_hydrolase_plant_like Diadenosine tetraphospha | 99.71 | |
| cd03673 | 131 | Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy | 99.71 | |
| PRK15393 | 180 | NUDIX hydrolase YfcD; Provisional | 99.71 | |
| cd04684 | 128 | Nudix_Hydrolase_25 Contains a crystal structure of | 99.71 | |
| cd04671 | 123 | Nudix_Hydrolase_13 Members of the Nudix hydrolase | 99.7 | |
| cd03429 | 131 | NADH_pyrophosphatase NADH pyrophosphatase, a membe | 99.7 | |
| PRK00714 | 156 | RNA pyrophosphohydrolase; Reviewed | 99.7 | |
| cd04669 | 121 | Nudix_Hydrolase_11 Members of the Nudix hydrolase | 99.69 | |
| cd04666 | 122 | Nudix_Hydrolase_9 Members of the Nudix hydrolase s | 99.68 | |
| cd04664 | 129 | Nudix_Hydrolase_7 Members of the Nudix hydrolase s | 99.68 | |
| cd03674 | 138 | Nudix_Hydrolase_1 Members of the Nudix hydrolase s | 99.68 | |
| cd04670 | 127 | Nudix_Hydrolase_12 Members of the Nudix hydrolase | 99.67 | |
| cd04681 | 130 | Nudix_Hydrolase_22 Members of the Nudix hydrolase | 99.67 | |
| cd04682 | 122 | Nudix_Hydrolase_23 Members of the Nudix hydrolase | 99.67 | |
| cd04696 | 125 | Nudix_Hydrolase_37 Members of the Nudix hydrolase | 99.67 | |
| PRK03759 | 184 | isopentenyl-diphosphate delta-isomerase; Provision | 99.66 | |
| cd03430 | 144 | GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann | 99.66 | |
| PRK00241 | 256 | nudC NADH pyrophosphatase; Reviewed | 99.65 | |
| cd03428 | 130 | Ap4A_hydrolase_human_like Diadenosine tetraphospha | 99.64 | |
| PRK15434 | 159 | GDP-mannose mannosyl hydrolase NudD; Provisional | 99.64 | |
| cd04689 | 125 | Nudix_Hydrolase_30 Members of the Nudix hydrolase | 99.64 | |
| cd03427 | 137 | MTH1 MutT homolog-1 (MTH1) is a member of the Nudi | 99.64 | |
| cd02885 | 165 | IPP_Isomerase Isopentenyl diphosphate (IPP) isomer | 99.64 | |
| cd04699 | 129 | Nudix_Hydrolase_39 Members of the Nudix hydrolase | 99.64 | |
| cd04677 | 132 | Nudix_Hydrolase_18 Members of the Nudix hydrolase | 99.63 | |
| cd04686 | 131 | Nudix_Hydrolase_27 Members of the Nudix hydrolase | 99.63 | |
| cd04678 | 129 | Nudix_Hydrolase_19 Members of the Nudix hydrolase | 99.63 | |
| PRK10707 | 190 | putative NUDIX hydrolase; Provisional | 99.63 | |
| PRK15472 | 141 | nucleoside triphosphatase NudI; Provisional | 99.63 | |
| PLN02325 | 144 | nudix hydrolase | 99.63 | |
| cd04690 | 118 | Nudix_Hydrolase_31 Members of the Nudix hydrolase | 99.62 | |
| cd04688 | 126 | Nudix_Hydrolase_29 Members of the Nudix hydrolase | 99.62 | |
| cd04511 | 130 | Nudix_Hydrolase_4 Members of the Nudix hydrolase s | 99.62 | |
| cd04667 | 112 | Nudix_Hydrolase_10 Members of the Nudix hydrolase | 99.61 | |
| cd04695 | 131 | Nudix_Hydrolase_36 Members of the Nudix hydrolase | 99.6 | |
| cd04672 | 123 | Nudix_Hydrolase_14 Members of the Nudix hydrolase | 99.6 | |
| cd04665 | 118 | Nudix_Hydrolase_8 Members of the Nudix hydrolase s | 99.57 | |
| TIGR02150 | 158 | IPP_isom_1 isopentenyl-diphosphate delta-isomerase | 99.56 | |
| PRK10546 | 135 | pyrimidine (deoxy)nucleoside triphosphate pyrophos | 99.56 | |
| cd04685 | 133 | Nudix_Hydrolase_26 Members of the Nudix hydrolase | 99.56 | |
| cd04676 | 129 | Nudix_Hydrolase_17 Members of the Nudix hydrolase | 99.55 | |
| cd04694 | 143 | Nudix_Hydrolase_35 Members of the Nudix hydrolase | 99.54 | |
| cd02883 | 123 | Nudix_Hydrolase Nudix hydrolase is a superfamily o | 99.52 | |
| cd04661 | 132 | MRP_L46 Mitochondrial ribosomal protein L46 (MRP L | 99.52 | |
| cd03425 | 124 | MutT_pyrophosphohydrolase The MutT pyrophosphohydr | 99.52 | |
| PRK10776 | 129 | nucleoside triphosphate pyrophosphohydrolase; Prov | 99.49 | |
| COG1051 | 145 | ADP-ribose pyrophosphatase [Nucleotide transport a | 99.48 | |
| cd04662 | 126 | Nudix_Hydrolase_5 Members of the Nudix hydrolase s | 99.48 | |
| TIGR00586 | 128 | mutt mutator mutT protein. All proteins in this fa | 99.48 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 99.43 | |
| PLN02791 | 770 | Nudix hydrolase homolog | 99.4 | |
| KOG3084|consensus | 345 | 99.38 | ||
| COG2816 | 279 | NPY1 NTP pyrophosphohydrolases containing a Zn-fin | 99.34 | |
| cd04663 | 126 | Nudix_Hydrolase_6 Members of the Nudix hydrolase s | 99.34 | |
| cd04674 | 118 | Nudix_Hydrolase_16 Members of the Nudix hydrolase | 99.31 | |
| PRK08999 | 312 | hypothetical protein; Provisional | 99.29 | |
| PLN02709 | 222 | nudix hydrolase | 99.29 | |
| PLN02552 | 247 | isopentenyl-diphosphate delta-isomerase | 99.27 | |
| COG0494 | 161 | MutT NTP pyrophosphohydrolases including oxidative | 99.18 | |
| KOG2839|consensus | 145 | 99.11 | ||
| cd03670 | 186 | ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) | 98.96 | |
| KOG3069|consensus | 246 | 98.78 | ||
| PLN02839 | 372 | nudix hydrolase | 98.5 | |
| COG1443 | 185 | Idi Isopentenyldiphosphate isomerase [Lipid metabo | 98.46 | |
| cd03431 | 118 | DNA_Glycosylase_C DNA glycosylase (MutY in bacteri | 98.32 | |
| KOG0648|consensus | 295 | 98.21 | ||
| COG4119 | 161 | Predicted NTP pyrophosphohydrolase [DNA replicatio | 98.1 | |
| PF14815 | 114 | NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 | 96.96 | |
| KOG0142|consensus | 225 | 96.59 | ||
| KOG4195|consensus | 275 | 96.08 | ||
| KOG2937|consensus | 348 | 95.88 | ||
| COG4112 | 203 | Predicted phosphoesterase (MutT family) [General f | 92.8 | |
| PF13869 | 188 | NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B | 89.97 | |
| KOG1689|consensus | 221 | 82.74 | ||
| KOG4313|consensus | 306 | 80.41 |
| >PRK15009 GDP-mannose pyrophosphatase NudK; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.2e-32 Score=230.66 Aligned_cols=178 Identities=21% Similarity=0.409 Sum_probs=151.4
Q ss_pred EeEEEEeeecCeeeEEEEEEe---ecCeE--eecccccceeeEeecCeEEEEEEEcCCCEEEEEEecCCcCCccccceec
Q psy11834 6 EAQIIETQSSQFIQPYSVKFV---QEALI--KENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQV 80 (230)
Q Consensus 6 ~~~~~~~~~~~~~~~~~~~~~---~~g~~--~~~~~~~~~~~~~~~~~v~vl~~~~~~~~vll~r~~~~~~~~~~~~~q~ 80 (230)
++...+++.++|+++++.+++ +||.. ..| +++.++++|+|++++.++++++|+| ||
T Consensus 6 ~~~~~~~~~~~~~~v~~~~~~~~~pdG~~~~~~r------~vv~~~~~v~Vl~~~~~~~~vvLvr-------------Qy 66 (191)
T PRK15009 6 TLIKDKILSDNYFTLHNITYDLTRKDGEVIRHKR------EVYDRGNGATILLYNAKKKTVVLIR-------------QF 66 (191)
T ss_pred EEEEEEEEeCCeEEEEEEEEEEECCCCCccceEE------EEEEECCEEEEEEEECCCCEEEEEE-------------cc
Confidence 355667789999999997754 68874 345 8999999999999987678999999 99
Q ss_pred ccceeccCCcccccCCccccccCCCCCCcEEEeeeeecCCCCCHHHHHHHHHHhhhCCccCCCceEEEEEEEcCCCccCe
Q psy11834 81 LLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGD 160 (230)
Q Consensus 81 r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~elPgG~VE~GEs~~eAA~REl~EETGl~v~~~~l~~l~~~~~~~~~s~~ 160 (230)
|++++.... ..+++||+|||.+|+| ++++||+|||+||||+.+ ..+.+++.+++++|.+++
T Consensus 67 R~~v~~~~~----------------~~~~~lElPAG~vd~~-~p~~aA~REL~EETGy~a--~~~~~l~~~~~spG~s~e 127 (191)
T PRK15009 67 RVATWVNGN----------------ESGQLIETCAGLLDND-EPEVCIRKEAIEETGYEV--GEVRKLFELYMSPGGVTE 127 (191)
T ss_pred cccccccCC----------------CCceEEEEeccccCCC-CHHHHHHHHHHHhhCCcc--ceEEEeeEEEcCCcccCc
Confidence 999864321 1579999999999976 799999999999999999 999999999999999999
Q ss_pred EEEEEEEEEcCcccccCCCCCCCceEEEEEEcHHHHHHHhhcCCCCChHHHHHHHHHHHHhh
Q psy11834 161 RQTLFFVEVTDDMKVNSGGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAK 222 (230)
Q Consensus 161 ~~~~y~a~~~~~~~~~~~~~~~~E~~~v~wv~~eE~~~~~~~~~~~~~~~~~~a~~~~~~~~ 222 (230)
.+|+|+|+.......+.+..+++|.++++|+|++++.+++.+|++.+ +.++.|++|++.++
T Consensus 128 ~~~lf~a~~~~~~~~~~~~~de~E~iev~~~~~~e~~~~i~~G~i~d-a~ti~al~~~~~~~ 188 (191)
T PRK15009 128 LIHFFIAEYSDSQRANAGGGVEDEDIEVLELPFSQALEMIKTGEIRD-GKTVLLLNYLQTSH 188 (191)
T ss_pred EEEEEEEEECchhcccCCCCCCCceEEEEEEcHHHHHHHHHcCCCCc-HHHHHHHHHHHHhc
Confidence 99999999753333344445788999999999999999999999997 78899999988763
|
|
| >PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional | Back alignment and domain information |
|---|
| >TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional | Back alignment and domain information |
|---|
| >KOG4432|consensus | Back alignment and domain information |
|---|
| >cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >KOG4432|consensus | Back alignment and domain information |
|---|
| >PLN03143 nudix hydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG3041|consensus | Back alignment and domain information |
|---|
| >cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex | Back alignment and domain information |
|---|
| >cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] | Back alignment and domain information |
|---|
| >cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK15393 NUDIX hydrolase YfcD; Provisional | Back alignment and domain information |
|---|
| >cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >PRK00714 RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional | Back alignment and domain information |
|---|
| >cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK00241 nudC NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional | Back alignment and domain information |
|---|
| >cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway | Back alignment and domain information |
|---|
| >cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10707 putative NUDIX hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK15472 nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >PLN02325 nudix hydrolase | Back alignment and domain information |
|---|
| >cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 | Back alignment and domain information |
|---|
| >PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR00586 mutt mutator mutT protein | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02791 Nudix hydrolase homolog | Back alignment and domain information |
|---|
| >KOG3084|consensus | Back alignment and domain information |
|---|
| >COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02709 nudix hydrolase | Back alignment and domain information |
|---|
| >PLN02552 isopentenyl-diphosphate delta-isomerase | Back alignment and domain information |
|---|
| >COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >KOG2839|consensus | Back alignment and domain information |
|---|
| >cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P | Back alignment and domain information |
|---|
| >KOG3069|consensus | Back alignment and domain information |
|---|
| >PLN02839 nudix hydrolase | Back alignment and domain information |
|---|
| >COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone | Back alignment and domain information |
|---|
| >KOG0648|consensus | Back alignment and domain information |
|---|
| >COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A | Back alignment and domain information |
|---|
| >KOG0142|consensus | Back alignment and domain information |
|---|
| >KOG4195|consensus | Back alignment and domain information |
|---|
| >KOG2937|consensus | Back alignment and domain information |
|---|
| >COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A | Back alignment and domain information |
|---|
| >KOG1689|consensus | Back alignment and domain information |
|---|
| >KOG4313|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 230 | ||||
| 3q91_A | 218 | Crystal Structure Of Human Uridine Diphosphate Gluc | 2e-22 | ||
| 3o6z_A | 191 | Structure Of The D152a E.Coli Gdp-Mannose Hydrolase | 2e-08 | ||
| 3o52_A | 191 | Structure Of The E.Coli Gdp-Mannose Hydrolase (Yffh | 3e-08 | ||
| 1viu_A | 203 | Crystal Structure Of Putative Adp Ribose Pyrophosph | 4e-08 | ||
| 3o61_A | 191 | Structure Of The E100a E.Coli Gdp-Mannose Hydrolase | 1e-07 | ||
| 1g0s_A | 209 | The Crystal Structure Of The E.Coli Adp-Ribose Pyro | 8e-04 |
| >pdb|3Q91|A Chain A, Crystal Structure Of Human Uridine Diphosphate Glucose Pyrophosphatase (Nudt14) Length = 218 | Back alignment and structure |
|
| >pdb|3O6Z|A Chain A, Structure Of The D152a E.Coli Gdp-Mannose Hydrolase (Yffh) In Complex With Mg++ Length = 191 | Back alignment and structure |
| >pdb|3O52|A Chain A, Structure Of The E.Coli Gdp-Mannose Hydrolase (Yffh) In Complex With Tartrate Length = 191 | Back alignment and structure |
| >pdb|1VIU|A Chain A, Crystal Structure Of Putative Adp Ribose Pyrophosphatase Length = 203 | Back alignment and structure |
| >pdb|3O61|A Chain A, Structure Of The E100a E.Coli Gdp-Mannose Hydrolase (Yffh) In Complex With Gdp-Mannose And Mg++ Length = 191 | Back alignment and structure |
| >pdb|1G0S|A Chain A, The Crystal Structure Of The E.Coli Adp-Ribose Pyrophosphatase Length = 209 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 230 | |||
| 3q91_A | 218 | Uridine diphosphate glucose pyrophosphatase; struc | 1e-32 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 2e-20 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 3e-15 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 3e-13 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 3e-12 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 1e-10 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 8e-10 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 2e-09 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 4e-07 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 2e-06 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 4e-06 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 5e-06 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 9e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 1xsa_A | 153 | BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, | 3e-04 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 6e-04 |
| >3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
Score = 116 bits (292), Expect = 1e-32
Identities = 58/160 (36%), Positives = 82/160 (51%), Gaps = 5/160 (3%)
Query: 68 QFIQPYSVKFVQVLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDK-NKSLAE 126
QF V +V + + P GVT+E CAG+VD+ SL E
Sbjct: 56 QFRPA--VYAGEVERRFPGSLAAVDQDGPRELQPALPGSAGVTVELCAGLVDQPGLSLEE 113
Query: 127 IAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFVEVTDDMKVNSGGGVDE--E 184
+A +E EECGY + L ++ T+ SGVG G RQT+F+ EVTD + GGG+ E E
Sbjct: 114 VACKEAWEECGYHLAPSDLRRVATYWSGVGLTGSRQTMFYTEVTDAQRSGPGGGLVEEGE 173
Query: 185 LIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAG 224
LIEVV + LE A+ + ++ G +F + WFL+ A
Sbjct: 174 LIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQVAP 213
|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Length = 191 | Back alignment and structure |
|---|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Length = 209 | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Length = 212 | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182 | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Length = 145 | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198 | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Length = 170 | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Length = 207 | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 230 | |||
| 3q91_A | 218 | Uridine diphosphate glucose pyrophosphatase; struc | 99.98 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 99.97 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 99.96 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 99.96 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 99.95 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 99.95 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 99.94 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 99.94 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 99.92 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 99.81 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 99.77 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 99.77 | |
| 3i7u_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.75 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 99.75 | |
| 3u53_A | 155 | BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; | 99.74 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 99.74 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 99.73 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 99.73 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 99.72 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 99.72 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 99.72 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 99.71 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 99.71 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 99.7 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 99.7 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 99.7 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 99.7 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 99.69 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 99.69 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.69 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 99.69 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 99.68 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 99.68 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 99.68 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 99.68 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 99.67 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 99.67 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 99.67 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 99.67 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 99.66 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 99.66 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 99.65 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 99.65 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 99.64 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 99.64 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 99.63 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 99.63 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 99.63 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 99.63 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 99.61 | |
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 99.6 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 99.6 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 99.59 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 99.57 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 99.57 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 99.56 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 99.55 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 99.54 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 99.53 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 99.53 | |
| 2dho_A | 235 | Isopentenyl-diphosphate delta-isomerase 1; alpha/b | 99.53 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 99.53 | |
| 1x51_A | 155 | A/G-specific adenine DNA glycosylase; nudix domain | 99.52 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 99.51 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 99.51 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 99.51 | |
| 2pny_A | 246 | Isopentenyl-diphosphate delta-isomerase 2; caroten | 99.51 | |
| 3qsj_A | 232 | Nudix hydrolase; structural genomics, PSI-biology, | 99.5 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 99.5 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 99.48 | |
| 3e57_A | 211 | Uncharacterized protein TM1382; structural genomic | 99.44 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 99.39 | |
| 3fsp_A | 369 | A/G-specific adenine glycosylase; protein-DNA comp | 99.25 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 99.19 | |
| 3bho_A | 208 | Cleavage and polyadenylation specificity factor su | 98.7 | |
| 3kvh_A | 214 | Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R | 98.7 | |
| 3rh7_A | 321 | Hypothetical oxidoreductase; FMN-binding split bar | 98.68 |
| >3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.98 E-value=1.1e-31 Score=230.12 Aligned_cols=190 Identities=30% Similarity=0.523 Sum_probs=127.5
Q ss_pred eeEEEEEEe-ecCeEeecccccceeeEeecCeEEEEEEEcCCCEEEEEEecCCcCCccccceecccceeccCCcc-----
Q psy11834 18 IQPYSVKFV-QEALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQVLLSVYINSIPE----- 91 (230)
Q Consensus 18 ~~~~~~~~~-~~g~~~~~~~~~~~~~~~~~~~v~vl~~~~~~~~vll~r~~~~~~~~~~~~~q~r~~~~~~~~~~----- 91 (230)
+...++++. +||....| +++.++++|+|++++.+++++||+| |||++.+.+.++.
T Consensus 13 ~~~~~~~~~~~~G~~~~~------e~v~~~~aV~vl~~~~~~~~vlLvr-------------Q~R~~~~~~~~~~~~~~~ 73 (218)
T 3q91_A 13 LGTENLYFQSMNGAQKSW------DFMKTHDSVTVLLFNSSRRSLVLVK-------------QFRPAVYAGEVERRFPGS 73 (218)
T ss_dssp ----------------------------CCCEEEEEEEEGGGTEEEEEE-------------EECHHHHHHHTC------
T ss_pred cceeEEEEECCCCCEEEE------EEEEcCCeEEEEEEECCCCEEEEEE-------------cccccccccccccccccc
Confidence 556777877 79998899 9999999999999997789999999 9999986433211
Q ss_pred ----cccCCccccccCCCCCCcEEEeeeeecCC-CCCHHHHHHHHHHhhhCCccCCCceEEEEEEEcCCCccCeEEEEEE
Q psy11834 92 ----EDRTGSIDVTKYPAELGVTLEFCAGIVDK-NKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFF 166 (230)
Q Consensus 92 ----~~~~~~~~~~~~~~~~~~~~elPgG~VE~-GEs~~eAA~REl~EETGl~v~~~~l~~l~~~~~~~~~s~~~~~~y~ 166 (230)
..+.-++.-.+||.+.+++|+||||++|+ ||++.+||+||++||||+.+.+..+..++.++++++.++..+++|+
T Consensus 74 ~~~~~~~~~~~~~~~~~~~~~~~welPgG~ve~~gEs~~eaA~REl~EEtGl~~~~~~l~~l~~~~~~~g~~~~~~~~f~ 153 (218)
T 3q91_A 74 LAAVDQDGPRELQPALPGSAGVTVELCAGLVDQPGLSLEEVACKEAWEECGYHLAPSDLRRVATYWSGVGLTGSRQTMFY 153 (218)
T ss_dssp -------------------CCEEEECEEEECCSSSCCHHHHHHHHHHHHHCBCCCGGGCEEEEEEEEC---CCEEEEEEE
T ss_pred ccccccccccccccccccCCCeEEECCcceeCCCCCCHHHHHHHHHHHHhCCccccCceEEEEEEecCCCccceEEEEEE
Confidence 01111233446888889999999999999 9999999999999999999876789999999998888899999999
Q ss_pred EEEcCcccccC--CCCCCCceEEEEEEcHHHHHHHhhcCCCCChHHHHHHHHHHHHhhcCCc
Q psy11834 167 VEVTDDMKVNS--GGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAGQY 226 (230)
Q Consensus 167 a~~~~~~~~~~--~~~~~~E~~~v~wv~~eE~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~ 226 (230)
+.+.....+.. ...+++|++++.|++++++.+++.+|++..+.+.++|++||+++|.+++
T Consensus 154 a~~~~~~~~~~~~~~~d~~E~~ev~wv~l~el~~~i~~g~i~~~~~~l~al~W~~~~~~~~~ 215 (218)
T 3q91_A 154 TEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQVAPNL 215 (218)
T ss_dssp EEECGGGBCC---------CCEEEEEEEGGGHHHHHHCTTSCBBHHHHHHHHHHHHHTGGGC
T ss_pred EEECCcccccCCCCCCCCCcEEEEEEEEHHHHHHHHHcCCCCccHHHHHHHHHHHhcccccc
Confidence 99765433222 2346889999999999999999999999888888899999999998764
|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A | Back alignment and structure |
|---|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 | Back alignment and structure |
|---|
| >3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A | Back alignment and structure |
|---|
| >3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} | Back alignment and structure |
|---|
| >3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* | Back alignment and structure |
|---|
| >3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A | Back alignment and structure |
|---|
| >3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* | Back alignment and structure |
|---|
| >3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A | Back alignment and structure |
|---|
| >3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 230 | ||||
| d1g0sa_ | 209 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escheri | 1e-10 | |
| d1viua_ | 189 | d.113.1.1 (A:) ADP-ribose pyrophosphatase homologu | 1e-10 | |
| d1v8ya_ | 158 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus | 3e-08 | |
| d1sjya_ | 158 | d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc | 1e-07 | |
| d1vcda1 | 126 | d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t | 8e-06 | |
| d1vhza_ | 186 | d.113.1.1 (A:) ADP compounds hydrolase NudE {Esche | 3e-05 | |
| d1mqea_ | 202 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobac | 2e-04 | |
| d1xsba_ | 153 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 2e-04 | |
| d2azwa1 | 147 | d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E | 6e-04 | |
| d2a6ta2 | 151 | d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c | 0.002 | |
| d2o5fa1 | 162 | d.113.1.2 (A:7-168) Hypothetical protein DR0079 {D | 0.004 |
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 209 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: MutT-like domain: ADP-ribose pyrophosphatase species: Escherichia coli [TaxId: 562]
Score = 56.6 bits (136), Expect = 1e-10
Identities = 27/118 (22%), Positives = 57/118 (48%), Gaps = 4/118 (3%)
Query: 108 GVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAGDRQTLFFV 167
LE AG++++ +S+ ++AR E +EE G V ++ + + +F + G +R ++
Sbjct: 89 PWLLEMVAGMIEEGESVEDVARREAIEEAGLIV--KRTKPVLSFLASPGGTSERSSIMVG 146
Query: 168 EVTDDMKVNSGGGVDE-ELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKAG 224
EV G DE E I V + E+A +++ + ++ + + + A+ W
Sbjct: 147 EVDATTASGIHGLADENEDIRVHVVSREQAYQWVEEGKIDN-AASVIALQWLQLHHQA 203
|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Length = 189 | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Length = 158 | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 | Back information, alignment and structure |
|---|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Length = 186 | Back information, alignment and structure |
|---|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 202 | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153 | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Length = 162 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 230 | |||
| d1g0sa_ | 209 | ADP-ribose pyrophosphatase {Escherichia coli [TaxI | 100.0 | |
| d1viua_ | 189 | ADP-ribose pyrophosphatase homologue YffH {Escheri | 100.0 | |
| d1mqea_ | 202 | ADP-ribose pyrophosphatase {Mycobacterium tubercul | 100.0 | |
| d1vhza_ | 186 | ADP compounds hydrolase NudE {Escherichia coli [Ta | 99.98 | |
| d1v8ya_ | 158 | ADP-ribose pyrophosphatase {Thermus thermophilus [ | 99.96 | |
| d1sjya_ | 158 | Hypothetical protein DR1025 {Deinococcus radiodura | 99.84 | |
| d2b0va1 | 146 | Hypothetical protein NE0184 {Nitrosomonas europaea | 99.8 | |
| d2fkba1 | 161 | Hypothetical protein YfcD {Escherichia coli [TaxId | 99.78 | |
| d1vk6a2 | 131 | NADH pyrophosphatase {Escherichia coli [TaxId: 562 | 99.76 | |
| d2o5fa1 | 162 | Hypothetical protein DR0079 {Deinococcus radiodura | 99.75 | |
| d1vcda1 | 126 | AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: | 99.75 | |
| d2a6ta2 | 151 | mRNA decapping enzyme Dcp2p catalytic domain {Schi | 99.72 | |
| d1hzta_ | 153 | Isopentenyl diphosphate isomerase {Escherichia col | 99.71 | |
| d2fvva1 | 135 | Diphosphoinositol polyphosphate phosphohydrolase { | 99.71 | |
| d2azwa1 | 147 | Hypothetical protein EF1141 {Enterococcus faecalis | 99.69 | |
| d1ryaa_ | 160 | GDP-mannose mannosyl hydrolase NudD {Escherichia c | 99.69 | |
| d1jkna_ | 165 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.68 | |
| d1ktga_ | 137 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.67 | |
| d2b06a1 | 155 | Hypothetical protein SP1235 (spr1115) {Streptococc | 99.67 | |
| d1xsba_ | 153 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.67 | |
| d1irya_ | 156 | 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum | 99.64 | |
| d1puna_ | 129 | Nucleoside triphosphate pyrophosphorylase (MutT) { | 99.64 | |
| d1nqza_ | 187 | Coenzyme A pyrophosphatase {Deinococcus radioduran | 99.62 | |
| d2fb1a2 | 147 | Hypothetical protein BT0354, N-terminal domain {Ba | 99.61 | |
| d2fmla2 | 202 | Hypothetical protein EF2700, N-terminal domain {En | 99.54 | |
| d1k2ea_ | 152 | Hypothetical protein PAE3301 {Archaeon Pyrobaculum | 99.5 | |
| d1rrqa2 | 127 | Adenine glycosylase MutY, C-terminal domain {Bacil | 99.22 | |
| d1q33a_ | 292 | NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { | 99.03 | |
| d1u20a1 | 196 | U8 snorna-binding protein x29 {African clawed frog | 99.02 | |
| d1x51a1 | 142 | A/G-specific adenine DNA glycosylase {Human (Homo | 98.87 |
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: MutT-like domain: ADP-ribose pyrophosphatase species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=7.2e-34 Score=240.49 Aligned_cols=184 Identities=16% Similarity=0.260 Sum_probs=149.7
Q ss_pred cceEeEEEEeeecCeeeEEEEEEee---cCeEeecccccceeeEeecCeEEEEEEEcCCCEEEEEEecCCcCCcccccee
Q psy11834 3 KITEAQIIETQSSQFIQPYSVKFVQ---EALIKENQYCHPQFLITQHKDYYIVMNKITEAQIIETRSSQFIQPYSVKFVQ 79 (230)
Q Consensus 3 ~~~~~~~~~~~~~~~~~~~~~~~~~---~g~~~~~~~~~~~~~~~~~~~v~vl~~~~~~~~vll~r~~~~~~~~~~~~~q 79 (230)
+++.++...++++ ||++.+++++. ||. +.....|+++.++++|+|++++..+++++|+| |
T Consensus 15 dv~il~~~~vy~G-~~~v~~~~~~~~~~dG~---~s~~~~rev~~~~~~v~vl~~~~~~~~vlLvr-------------Q 77 (209)
T d1g0sa_ 15 DVEIIARETLYRG-FFSLDLYRFRHRLFNGQ---MSHEVRREIFERGHAAVLLPFDPVRDEVVLIE-------------Q 77 (209)
T ss_dssp GEEEEEEEEEEES-SSEEEEEEEEEBCTTSC---BCCCEEEEEEECCCEEEEEEEETTTTEEEEEE-------------E
T ss_pred ceEEEEEEEEEcC-eEEEEEEEEEEECCCCC---cccEEEEEEEecCCEEEEEEEEecCCeEEEEE-------------E
Confidence 3566677777776 88887776653 554 32233458999999999999997789999999 9
Q ss_pred cccceeccCCcccccCCccccccCCCCCCcEEEeeeeecCCCCCHHHHHHHHHHhhhCCccCCCceEEEEEEEcCCCccC
Q psy11834 80 VLLSVYINSIPEEDRTGSIDVTKYPAELGVTLEFCAGIVDKNKSLAEIAREEVLEECGYDVPVEKLEKIQTFRSGVGSAG 159 (230)
Q Consensus 80 ~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~elPgG~VE~GEs~~eAA~REl~EETGl~v~~~~l~~l~~~~~~~~~s~ 159 (230)
||++++.... .+|.||+|||.+|+|||+++||+|||+|||||.+ ..+..++.++++++.++
T Consensus 78 ~R~~~~~~~~-----------------~~~~lElPAG~id~gE~p~~aA~REL~EEtG~~~--~~l~~l~~~~~spg~~~ 138 (209)
T d1g0sa_ 78 IRIAAYDTSE-----------------TPWLLEMVAGMIEEGESVEDVARREAIEEAGLIV--KRTKPVLSFLASPGGTS 138 (209)
T ss_dssp ECGGGGGGSS-----------------CSEEEECEEEECCTTCCHHHHHHHHHHHHHCCCC--CCEEEEEEEESCTTTBC
T ss_pred EeccccccCC-----------------CceEEeeceeecCCCcCHHHHHHHHHHhhhcccc--cceeeccccccCCcccC
Confidence 9999864321 5789999999999999999999999999999999 89999999999999999
Q ss_pred eEEEEEEEEEcCcccccC-CCCCCCceEEEEEEcHHHHHHHhhcCCCCChHHHHHHHHHHHHhhc
Q psy11834 160 DRQTLFFVEVTDDMKVNS-GGGVDEELIEVVEMGLEEAREYLAQDEVRSPSGFLFAMHWFLAAKA 223 (230)
Q Consensus 160 ~~~~~y~a~~~~~~~~~~-~~~~~~E~~~v~wv~~eE~~~~~~~~~~~~~~~~~~a~~~~~~~~~ 223 (230)
+.+++|+|.++.....+. +..+++|.++++|++++|+.+++.+|+|.+ +.|++|++|+..+++
T Consensus 139 e~~~~f~a~~~~~~~~~~~~~~de~E~iev~~v~~~e~~~~i~~g~I~d-a~ti~al~~~~l~~~ 202 (209)
T d1g0sa_ 139 ERSSIMVGEVDATTASGIHGLADENEDIRVHVVSREQAYQWVEEGKIDN-AASVIALQWLQLHHQ 202 (209)
T ss_dssp CEEEEEEEECCGGGCC--------CCSCEEEEEEHHHHHHHHHTTSSCB-HHHHHHHHHHHHHHH
T ss_pred CceEEEEEEEecccccCCCCCCCCCceeEEEEEeHHHHHHHHHcCCCCc-HHHHHHHHHHHHhHH
Confidence 999999998654332221 123678899999999999999999999997 778999999988764
|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} | Back information, alignment and structure |
|---|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|