Diaphorina citri psyllid: psy1183


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MLQRISSILSIFSFSSTHFWGPVANWGIPLAAIADLKKDPSIISGKMTFALCLYSIVFMRFAWKVQPRNLLLLSCHFTNECAQIVQGSRFIKYNYIDSKKEQQSKS
cHHHHHHHHcccccccEECccccccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHEEEcccccHHHHccc
*****SSILSIFSFSSTHFWGPVANWGIPLAAIADLKKDPSIISGKMTFALCLYSIVFMRFAWKVQPRNLLLLSCHFTNECAQIVQGSRFIKYNYI**********
xxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQRISSILSIFSFSSTHFWGPVANWGIPLAAIADLKKDPSIISGKMTFALCLYSIVFMRFAWKVQPRNLLLLSCHFTNECAQIVQGSRFIKYNYIDSKKEQQSKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial pyruvate carrier 1 Mediates the uptake of pyruvate into mitochondria.very confidentQ7KSC4
Mitochondrial pyruvate carrier 1 very confidentQ9Y5U8
Mitochondrial pyruvate carrier 1 very confidentP63030

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005774 [CC]vacuolar membraneconfidentGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005743 [CC]mitochondrial inner membraneconfidentGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0050833 [MF]pyruvate transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008028, GO:0005215, GO:0008509, GO:0015075, GO:0008514, GO:0022857, GO:0003674, GO:0046943
GO:0031305 [CC]integral to mitochondrial inner membraneprobableGO:0044464, GO:0031975, GO:0031304, GO:0043229, GO:0031301, GO:0031300, GO:0032592, GO:0043227, GO:0043226, GO:0031224, GO:0005737, GO:0005575, GO:0031090, GO:0016021, GO:0016020, GO:0044444, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0005740, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0006090 [BP]pyruvate metabolic processprobableGO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0032787, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0006850 [BP]mitochondrial pyruvate transportprobableGO:0051234, GO:0015718, GO:0071702, GO:0046907, GO:0006848, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0051179, GO:0044765, GO:0008150, GO:0051649, GO:0006839, GO:0044763, GO:0009987, GO:0051641, GO:0006820, GO:0044699, GO:0046942
GO:0006301 [BP]postreplication repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0009060 [BP]aerobic respirationprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0045333, GO:0008152, GO:0008150, GO:0006091, GO:0055114
GO:0006096 [BP]glycolysisprobableGO:0071704, GO:0019320, GO:1901575, GO:0005975, GO:0044238, GO:0046365, GO:0005996, GO:0009987, GO:0019318, GO:0044237, GO:0016052, GO:0008150, GO:0008152, GO:0044723, GO:0006091, GO:0006007, GO:0009056, GO:0006006, GO:0044724
GO:0046686 [BP]response to cadmium ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted