Diaphorina citri psyllid: psy11848


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MQYIDPRVNDWFLMESPIPTLVMVGIYLYIVVFLGPWIMANRKPFKLKTVLIVYNAAQVIFSLAMLWEHLMSGWLLDYSYKCQPVDYSHNPTALRHLMSGWLLDYSYKCQPVDYSHNPTALRVSFWVIIECFNQGGHGTFSNLINNIVHVIMYFYYMVSAMGPEYQKYLWWKRHLTTLTVPSLT
cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEECcccccHHHHHHHHHHEEEEEEccccccccccccccHHHHHHHHHHHcccccccccccEEcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccc
***IDPRVNDWFLMESPIPTLVMVGIYLYIVVFLGPWIMANRKPFKLKTVLIVYNAAQVIFSLAMLWEHLMSGWLLDYSYKCQPVDYSHNPTALRHLMSGWLLDYSYKCQPVDYSHNPTALRVSFWVIIECFNQGGHGTFSNLINNIVHVIMYFYYMVSAMGPEYQKYLWWKRHLTTLTVPSLT
xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQYIDPRVNDWFLMESPIPTLVMVGIYLYIVVFLGPWIMANRKPFKLKTVLIVYNAAQVIFSLAMLWEHLMSGWLLDYSYKCQPVDYSHNPTALRHLMSGWLLDYSYKCQPVDYSHNPTALRVSFWVIIECFNQGGHGTFSNLINNIVHVIMYFYYMVSAMGPEYQKYLWWKRHLTTLTVPSLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongation of very long chain fatty acids protein 7 Condensing enzyme that catalyzes the synthesis of saturated and polyunsaturated very long chain fatty acids. Highest activity toward C18 acyl-CoAs.confidentQ9D2Y9
Elongation of very long chain fatty acids protein 7 Condensing enzyme that catalyzes the synthesis of saturated and polyunsaturated very long chain fatty acids. Highest activity toward C18 acyl-CoAs.confidentA0JNC4
Elongation of very long chain fatty acids protein 7 Condensing enzyme that catalyzes the synthesis of saturated and polyunsaturated very long chain fatty acids. Highest activity toward C18 acyl-CoAs.confidentD4ADY9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0042761 [BP]very long-chain fatty acid biosynthetic processprobableGO:0006633, GO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0000038, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0009922 [MF]fatty acid elongase activityprobableGO:0004312, GO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0003674
GO:0034625 [BP]fatty acid elongation, monounsaturated fatty acidprobableGO:0006633, GO:0006631, GO:0019752, GO:0016053, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0030497, GO:0044237, GO:0019368
GO:0034626 [BP]fatty acid elongation, polyunsaturated fatty acidprobableGO:0006633, GO:0006631, GO:0019752, GO:0016053, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0030497, GO:0044237, GO:0019368
GO:0019367 [BP]fatty acid elongation, saturated fatty acidprobableGO:0006633, GO:0006631, GO:0019752, GO:0016053, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0030497, GO:0044237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted