Diaphorina citri psyllid: psy1185


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITVTGLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWADPQEEPDTETMSKVLMLDQQL
cccccEEEEccccccccHHHHHHHHHccccEEEEEEEccEEEEEEccHHHHHHHHccccEEEEcccccccccccEEEccccccccHHHHHHHHccccEEECccEEEEEECcccccccHHHHHHHHHHHccc
*SKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITVTGLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWADPQE**********LMLDQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITVTGLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWADPQEEPDTETMSKVLMLDQQL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heterogeneous nuclear ribonucleoprotein R Component of ribonucleosomes, which are complexes of at least 20 other different heterogenious nuclear ribonucleoproteins (hnRNP). hnRNP play an important role in processing of precursor mRNA in the nucleus.confidentO43390

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035770 [CC]ribonucleoprotein granuleprobableGO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0030529, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0070934 [BP]CRD-mediated mRNA stabilizationprobableGO:0019222, GO:0043489, GO:0043488, GO:0043487, GO:0010608, GO:0050789, GO:0060255, GO:0065007, GO:0048255, GO:0008150, GO:0065008, GO:0010468
GO:0070937 [CC]CRD-mediated mRNA stability complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0071346 [BP]cellular response to interferon-gammaprobableGO:0002376, GO:0051716, GO:0034097, GO:0071345, GO:0050896, GO:0045087, GO:0009987, GO:0006950, GO:0034341, GO:0006952, GO:0071310, GO:0044763, GO:0008150, GO:0070887, GO:0006955, GO:0042221, GO:0010033, GO:0044699
GO:0008143 [MF]poly(A) RNA bindingprobableGO:0005488, GO:0097159, GO:0070717, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:1901363, GO:0003729
GO:0005720 [CC]nuclear heterochromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000792, GO:0000790, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0071204 [CC]histone pre-mRNA 3'end processing complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0004131 [MF]cytosine deaminase activityprobableGO:0016787, GO:0016810, GO:0016814, GO:0003824, GO:0019239, GO:0003674
GO:0007310 [BP]oocyte dorsal/ventral axis specificationprobableGO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0007309, GO:0007308, GO:0009798, GO:0010259, GO:0007275, GO:0044699, GO:0007389, GO:0000003, GO:0003006, GO:0048869, GO:0007276, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0019953, GO:0007281, GO:0022414, GO:0008150, GO:0003002, GO:0022412, GO:0044767, GO:0044702, GO:0009953, GO:0044707, GO:0009950, GO:0048856, GO:0044763
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0046843 [BP]dorsal appendage formationprobableGO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0010927, GO:0007292, GO:0007304, GO:0007306, GO:0009653, GO:0044699, GO:0007276, GO:0000003, GO:0030703, GO:0030707, GO:0016043, GO:0032989, GO:0071840, GO:0048477, GO:0048646, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0044702, GO:0003006, GO:0048856, GO:0048869, GO:0044763
GO:0046011 [BP]regulation of oskar mRNA translationprobableGO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0006417, GO:0008150, GO:0010468
GO:0008380 [BP]RNA splicingprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YH0, chain A
Confidence level:very confident
Coverage over the Query: 4-116
View the alignment between query and template
View the model in PyMOL