Psyllid ID: psy1185


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITVTGLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWADPQEEPDTETMSKVLMLDQQL
cccccEEEEccccccccHHHHHHHHHccccEEEEEEEccEEEEEEccHHHHHHHHccccEEEEcccccccccccEEEccccccccHHHHHHHHccccEEEEccEEEEEEEcccccccHHHHHHHHHHHccc
cccEEEEEEEcccccccHHHHHHHHHHcccHHHHHHHccEEEEEEccHHHHEEccccEEEEEEcccccccccccEEEEEEccHHHHHHHHHHHccccEEEcccEEEEEcccccccccHHHHHHcEEEcccc
MSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITVTGLSQVIIysspddnkknrgfcfleydshksaSLAKKRLATGRLkvwgcdiivdwadpqeepdteTMSKVLMLDQQL
MSKVKVLYVRNLTQYCTEEKLKEAfeqygrvervKRIKDYAFVHFedrqeaitvtgLSQVIIYsspddnkknRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVdwadpqeepdtetMSKVLMLDQQL
MSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITVTGLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWADPQEEPDTETMSKVLMLDQQL
***VKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITVTGLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWA*********************
*SKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITVTGLSQVIIY****************Y************LATGRLKVWGCDIIVDWADPQE**********LMLDQ**
MSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITVTGLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWADPQEEPDTETMSKVLMLDQQL
*SKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITVTGLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWADPQEEPDTETMSKVLMLDQ*L
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITVTGLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWADPQEEPDTETMSKVLMLDQQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query131 2.2.26 [Sep-21-2011]
O43390 633 Heterogeneous nuclear rib yes N/A 0.549 0.113 0.625 8e-23
Q7TMK9 623 Heterogeneous nuclear rib no N/A 0.480 0.101 0.597 1e-21
O60506 623 Heterogeneous nuclear rib no N/A 0.480 0.101 0.597 1e-21
Q7TP47 533 Heterogeneous nuclear rib no N/A 0.480 0.118 0.597 1e-21
Q9NQ94 594 APOBEC1 complementation f no N/A 0.526 0.116 0.5 3e-17
Q5R9H4 587 APOBEC1 complementation f no N/A 0.526 0.117 0.5 3e-17
P86049 533 Probable RNA-binding prot no N/A 0.534 0.131 0.5 6e-17
Q4R2Z0 485 Probable RNA-binding prot N/A N/A 0.534 0.144 0.5 6e-17
Q8TBY0 533 Probable RNA-binding prot no N/A 0.534 0.131 0.5 6e-17
Q08BH5 510 Probable RNA-binding prot no N/A 0.625 0.160 0.481 9e-17
>sp|O43390|HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 Back     alignment and function desciption
 Score =  105 bits (262), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 45/72 (62%), Positives = 57/72 (79%)

Query: 56  GLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWADPQEE 115
           GL  VI+Y  PDD KKNRGFCFLEY+ HKSA+ A++RL +G++KVWG  + V+WADP EE
Sbjct: 272 GLVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEE 331

Query: 116 PDTETMSKVLML 127
           PD E M+KV +L
Sbjct: 332 PDPEVMAKVKVL 343




Component of ribonucleosomes, which are complexes of at least 20 other different heterogenious nuclear ribonucleoproteins (hnRNP). hnRNP play an important role in processing of precursor mRNA in the nucleus.
Homo sapiens (taxid: 9606)
>sp|Q7TMK9|HNRPQ_MOUSE Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus GN=Syncrip PE=1 SV=2 Back     alignment and function description
>sp|O60506|HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 Back     alignment and function description
>sp|Q7TP47|HNRPQ_RAT Heterogeneous nuclear ribonucleoprotein Q OS=Rattus norvegicus GN=Syncrip PE=2 SV=1 Back     alignment and function description
>sp|Q9NQ94|A1CF_HUMAN APOBEC1 complementation factor OS=Homo sapiens GN=A1CF PE=1 SV=1 Back     alignment and function description
>sp|Q5R9H4|A1CF_PONAB APOBEC1 complementation factor OS=Pongo abelii GN=A1CF PE=2 SV=1 Back     alignment and function description
>sp|P86049|RBM46_MOUSE Probable RNA-binding protein 46 OS=Mus musculus GN=Rbm46 PE=4 SV=1 Back     alignment and function description
>sp|Q4R2Z0|RBM46_MACFA Probable RNA-binding protein 46 OS=Macaca fascicularis GN=RBM46 PE=2 SV=2 Back     alignment and function description
>sp|Q8TBY0|RBM46_HUMAN Probable RNA-binding protein 46 OS=Homo sapiens GN=RBM46 PE=2 SV=1 Back     alignment and function description
>sp|Q08BH5|RBM46_DANRE Probable RNA-binding protein 46 OS=Danio rerio GN=rbm46 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
242011880 548 Heterogeneous nuclear ribonucleoprotein 0.564 0.135 0.824 4e-31
391324923 558 PREDICTED: heterogeneous nuclear ribonuc 0.488 0.114 0.810 4e-31
195113079 721 GI10594 [Drosophila mojavensis] gi|19391 0.488 0.088 0.824 4e-31
195390987 789 GJ22950 [Drosophila virilis] gi|19415223 0.488 0.081 0.824 5e-31
332026895 724 Heterogeneous nuclear ribonucleoprotein 0.564 0.102 0.810 5e-31
307212325 649 Heterogeneous nuclear ribonucleoprotein 0.564 0.114 0.810 6e-31
350409228 664 PREDICTED: heterogeneous nuclear ribonuc 0.564 0.111 0.810 6e-31
328789990 664 PREDICTED: heterogeneous nuclear ribonuc 0.564 0.111 0.810 6e-31
195449649 731 GK22469 [Drosophila willistoni] gi|19416 0.488 0.087 0.824 6e-31
383847619 664 PREDICTED: heterogeneous nuclear ribonuc 0.564 0.111 0.810 6e-31
>gi|242011880|ref|XP_002426671.1| Heterogeneous nuclear ribonucleoprotein Q, putative [Pediculus humanus corporis] gi|212510842|gb|EEB13933.1| Heterogeneous nuclear ribonucleoprotein Q, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 68/74 (91%)

Query: 54  VTGLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWADPQ 113
             GL++VIIYSSPDD KKNRGFCFLEY+SHK+ASLAK+RL TGR+KVWGCDIIVDWADPQ
Sbjct: 282 AAGLTKVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRVKVWGCDIIVDWADPQ 341

Query: 114 EEPDTETMSKVLML 127
           EEPD ETMSKV +L
Sbjct: 342 EEPDAETMSKVKVL 355




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|391324923|ref|XP_003736991.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|195113079|ref|XP_002001097.1| GI10594 [Drosophila mojavensis] gi|193917691|gb|EDW16558.1| GI10594 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195390987|ref|XP_002054147.1| GJ22950 [Drosophila virilis] gi|194152233|gb|EDW67667.1| GJ22950 [Drosophila virilis] Back     alignment and taxonomy information
>gi|332026895|gb|EGI66996.1| Heterogeneous nuclear ribonucleoprotein Q [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307212325|gb|EFN88129.1| Heterogeneous nuclear ribonucleoprotein Q [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350409228|ref|XP_003488661.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328789990|ref|XP_392307.4| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like [Apis mellifera] Back     alignment and taxonomy information
>gi|195449649|ref|XP_002072163.1| GK22469 [Drosophila willistoni] gi|194168248|gb|EDW83149.1| GK22469 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|383847619|ref|XP_003699450.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
FB|FBgn0038826 711 Syp "Syncrip" [Drosophila mela 0.549 0.101 0.833 9.5e-31
UNIPROTKB|F1NWI9 622 SYNCRIP "Uncharacterized prote 0.603 0.127 0.575 3.3e-22
UNIPROTKB|F1LUZ6381 Hnrnpr "Protein Hnrnpr" [Rattu 0.603 0.207 0.6 5.5e-22
RGD|1305683 533 Syncrip "synaptotagmin binding 0.603 0.148 0.575 9e-22
UNIPROTKB|Q7TP47 533 Syncrip "Heterogeneous nuclear 0.603 0.148 0.575 9e-22
UNIPROTKB|F6XIK8 562 SYNCRIP "Uncharacterized prote 0.603 0.140 0.575 1.2e-21
UNIPROTKB|E2QVD3 622 SYNCRIP "Uncharacterized prote 0.603 0.127 0.575 1.9e-21
UNIPROTKB|O60506 623 SYNCRIP "Heterogeneous nuclear 0.603 0.126 0.575 1.9e-21
MGI|MGI:1891690 623 Syncrip "synaptotagmin binding 0.603 0.126 0.575 1.9e-21
UNIPROTKB|F2Z5D4 627 SYNCRIP "Uncharacterized prote 0.603 0.125 0.575 1.9e-21
FB|FBgn0038826 Syp "Syncrip" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 332 (121.9 bits), Expect = 9.5e-31, Sum P(2) = 9.5e-31
 Identities = 60/72 (83%), Positives = 67/72 (93%)

Query:    56 GLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWADPQEE 115
             GL +VIIYSSPDD KKNRGFCFLEY+SHK+ASLAK+RL TGR+KVWGCDIIVDWADPQEE
Sbjct:   271 GLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEE 330

Query:   116 PDTETMSKVLML 127
             PD +TMSKV +L
Sbjct:   331 PDEQTMSKVKVL 342


GO:0003729 "mRNA binding" evidence=ISS;IDA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
GO:0022008 "neurogenesis" evidence=IMP
GO:0046011 "regulation of oskar mRNA translation" evidence=IMP
GO:0007310 "oocyte dorsal/ventral axis specification" evidence=IMP
GO:0046843 "dorsal appendage formation" evidence=IMP
GO:0035770 "ribonucleoprotein granule" evidence=IDA
UNIPROTKB|F1NWI9 SYNCRIP "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1LUZ6 Hnrnpr "Protein Hnrnpr" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1305683 Syncrip "synaptotagmin binding, cytoplasmic RNA interacting protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q7TP47 Syncrip "Heterogeneous nuclear ribonucleoprotein Q" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F6XIK8 SYNCRIP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QVD3 SYNCRIP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O60506 SYNCRIP "Heterogeneous nuclear ribonucleoprotein Q" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1891690 Syncrip "synaptotagmin binding, cytoplasmic RNA interacting protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5D4 SYNCRIP "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O43390HNRPR_HUMANNo assigned EC number0.6250.54960.1137yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 3e-30
cd1225082 cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 1e-26
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 2e-25
cd1248885 cd12488, RRM2_hnRNPR, RNA recognition motif 2 in v 4e-22
cd1248985 cd12489, RRM2_hnRNPQ, RNA recognition motif 2 in v 2e-21
cd1249189 cd12491, RRM2_RBM47, RNA recognition motif 2 in ve 1e-18
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 2e-18
cd1249085 cd12490, RRM2_ACF, RNA recognition motif 2 in vert 2e-18
cd1249285 cd12492, RRM2_RBM46, RNA recognition motif 2 found 3e-17
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 2e-16
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 3e-16
cd1249883 cd12498, RRM3_ACF, RNA recognition motif 3 in vert 2e-14
cd1249774 cd12497, RRM3_RBM47, RNA recognition motif 3 in ve 4e-14
pfam0007670 pfam00076, RRM_1, RNA recognition motif 6e-14
cd1249674 cd12496, RRM3_RBM46, RNA recognition motif 3 in ve 1e-13
smart0036073 smart00360, RRM, RNA recognition motif 4e-13
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 8e-12
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-11
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 1e-09
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 7e-09
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 7e-09
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 2e-08
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 2e-08
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 3e-08
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-08
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 4e-08
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 6e-08
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 1e-07
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 1e-07
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 1e-07
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 1e-07
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 2e-07
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 2e-07
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 3e-07
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 3e-07
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 3e-07
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 3e-07
cd1268681 cd12686, RRM1_PTBPH1_PTBPH2, RNA recognition motif 4e-07
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 4e-07
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 5e-07
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 7e-07
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 1e-06
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-06
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 1e-06
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 1e-06
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 2e-06
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 3e-06
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 3e-06
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 4e-06
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 5e-06
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 5e-06
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 6e-06
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 7e-06
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 7e-06
cd1268980 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 9e-06
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 9e-06
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 1e-05
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-05
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 2e-05
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 2e-05
pfam1389356 pfam13893, RRM_5, RNA recognition motif 2e-05
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-05
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 2e-05
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 2e-05
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 3e-05
cd1249383 cd12493, RRM2_DND1, RNA recognition motif 2 found 5e-05
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 5e-05
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 5e-05
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 6e-05
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 7e-05
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 7e-05
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 8e-05
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 8e-05
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 8e-05
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 9e-05
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-04
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 1e-04
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 1e-04
TIGR01649 481 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus spl 1e-04
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 1e-04
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 1e-04
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 2e-04
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 2e-04
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-04
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 2e-04
cd1234875 cd12348, RRM1_SHARP, RNA recognition motif 1 in SM 2e-04
cd1223472 cd12234, RRM1_AtRSp31_like, RNA recognition motif 3e-04
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 3e-04
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 3e-04
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 3e-04
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 3e-04
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 3e-04
cd1259080 cd12590, RRM2_PSF, RNA recognition motif 2 in vert 3e-04
cd12294102 cd12294, RRM_Rrp7A, RNA recognition motif in ribos 3e-04
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 4e-04
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 4e-04
cd1259180 cd12591, RRM2_p54nrb, RNA recognition motif 2 in v 4e-04
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 4e-04
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 5e-04
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 5e-04
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 5e-04
cd1225772 cd12257, RRM1_RBM26_like, RNA recognition motif 1 5e-04
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 6e-04
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 6e-04
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 6e-04
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 7e-04
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 7e-04
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 8e-04
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 8e-04
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 8e-04
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 9e-04
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 0.001
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 0.001
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 0.001
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 0.001
cd1246670 cd12466, RRM2_AtRSp31_like, RNA recognition motif 0.001
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 0.001
cd1244373 cd12443, RRM_MCM3A_like, RNA recognition motif in 0.001
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 0.001
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 0.001
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 0.002
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 0.002
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 0.002
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 0.002
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 0.002
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 0.002
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 0.002
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 0.002
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 0.002
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 0.002
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 0.003
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 0.003
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 0.003
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 0.003
cd1264377 cd12643, RRM_CFIm68, RNA recognition motif of pre- 0.004
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 0.004
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 0.004
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 0.004
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
 Score =  112 bits (282), Expect = 3e-30
 Identities = 40/80 (50%), Positives = 60/80 (75%), Gaps = 1/80 (1%)

Query: 49  QEAITVT-GLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIV 107
           +E   VT G+  VI+Y S  D KKNRGF F+EY+SH++A++A+++L  GR+++WG  I V
Sbjct: 157 EEFSKVTEGVVDVIVYHSAADKKKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHVIAV 216

Query: 108 DWADPQEEPDTETMSKVLML 127
           DWA+P+EE D + M+KV +L
Sbjct: 217 DWAEPEEEVDEDVMAKVKIL 236


Sequences in this subfamily include the human heterogeneous nuclear ribonucleoproteins (hnRNP) R , Q and APOBEC-1 complementation factor (aka APOBEC-1 stimulating protein). These proteins contain three RNA recognition domains (rrm: pfam00076) and a somewhat variable C-terminal domain. Length = 578

>gnl|CDD|240696 cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240932 cd12488, RRM2_hnRNPR, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240933 cd12489, RRM2_hnRNPQ, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240935 cd12491, RRM2_RBM47, RNA recognition motif 2 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240934 cd12490, RRM2_ACF, RNA recognition motif 2 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240936 cd12492, RRM2_RBM46, RNA recognition motif 2 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240940 cd12496, RRM3_RBM46, RNA recognition motif 3 in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241130 cd12686, RRM1_PTBPH1_PTBPH2, RNA recognition motif 1 in plant polypyrimidine tract-binding protein homolog 1 and 2 (PTBPH1 and PTBPH2) Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241133 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240937 cd12493, RRM2_DND1, RNA recognition motif 2 found in vertebrate dead end protein homolog 1 (DND1) Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240794 cd12348, RRM1_SHARP, RNA recognition motif 1 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241034 cd12590, RRM2_PSF, RNA recognition motif 2 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|240740 cd12294, RRM_Rrp7A, RNA recognition motif in ribosomal RNA-processing protein 7 homolog A (Rrp7A) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241035 cd12591, RRM2_p54nrb, RNA recognition motif 2 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240703 cd12257, RRM1_RBM26_like, RNA recognition motif 1 in vertebrate RNA-binding protein 26 (RBM26) and similar proteins Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240912 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2 in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240889 cd12443, RRM_MCM3A_like, RNA recognition motif in 80 kDa MCM3-associated protein (Map80) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241087 cd12643, RRM_CFIm68, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 131
KOG0117|consensus 506 99.94
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.87
KOG0144|consensus 510 99.86
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.86
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.85
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.84
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.83
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.8
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.78
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.77
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.77
KOG0109|consensus 346 99.77
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.77
KOG0131|consensus203 99.74
KOG0122|consensus270 99.73
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.73
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.72
KOG0145|consensus 360 99.72
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.72
PLN03120 260 nucleic acid binding protein; Provisional 99.72
KOG0127|consensus 678 99.71
KOG0149|consensus 247 99.68
KOG0121|consensus153 99.68
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.68
KOG0117|consensus 506 99.67
KOG0148|consensus321 99.67
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.63
KOG0107|consensus195 99.63
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.61
KOG0145|consensus360 99.61
KOG0148|consensus 321 99.61
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.61
PLN03213 759 repressor of silencing 3; Provisional 99.6
KOG0113|consensus 335 99.59
KOG4207|consensus 256 99.59
smart0036272 RRM_2 RNA recognition motif. 99.58
KOG0125|consensus 376 99.57
KOG0146|consensus 371 99.57
PLN03121 243 nucleic acid binding protein; Provisional 99.56
KOG0111|consensus 298 99.53
KOG0126|consensus219 99.53
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.52
KOG0105|consensus 241 99.52
KOG0124|consensus 544 99.51
KOG0108|consensus 435 99.51
smart0036071 RRM RNA recognition motif. 99.5
KOG0127|consensus 678 99.5
KOG0130|consensus170 99.5
KOG0114|consensus124 99.5
KOG0144|consensus 510 99.49
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.49
KOG0110|consensus725 99.48
KOG0123|consensus 369 99.45
KOG4206|consensus 221 99.44
KOG0123|consensus 369 99.42
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.42
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.41
KOG4205|consensus 311 99.41
KOG0132|consensus 894 99.32
KOG0153|consensus377 99.3
smart0036170 RRM_1 RNA recognition motif. 99.28
KOG0146|consensus371 99.21
KOG4661|consensus 940 99.16
KOG0415|consensus 479 99.14
KOG0106|consensus216 99.14
KOG0147|consensus 549 99.13
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.11
KOG4208|consensus214 99.08
KOG0147|consensus 549 99.06
KOG0110|consensus 725 99.03
KOG4212|consensus 608 99.01
KOG4212|consensus608 98.93
KOG1190|consensus 492 98.92
KOG0151|consensus 877 98.89
KOG1456|consensus 494 98.89
KOG1548|consensus 382 98.88
KOG0116|consensus419 98.88
KOG1457|consensus 284 98.81
KOG0533|consensus243 98.76
KOG0124|consensus 544 98.75
KOG4211|consensus 510 98.73
KOG0109|consensus 346 98.73
KOG4660|consensus 549 98.73
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.66
KOG4209|consensus231 98.64
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.6
KOG0120|consensus500 98.52
KOG0226|consensus290 98.51
KOG1190|consensus 492 98.5
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.43
KOG4454|consensus 267 98.41
KOG4205|consensus311 98.29
KOG0129|consensus520 98.24
KOG1457|consensus284 98.19
KOG4206|consensus221 98.12
KOG4210|consensus285 97.93
KOG0112|consensus 975 97.88
KOG1995|consensus 351 97.8
KOG0120|consensus 500 97.79
KOG3152|consensus278 97.77
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.74
KOG1365|consensus 508 97.7
KOG0128|consensus881 97.69
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.69
KOG2193|consensus 584 97.64
KOG4211|consensus 510 97.63
KOG0131|consensus203 97.55
KOG1548|consensus382 97.53
KOG1855|consensus 484 97.45
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.4
KOG2314|consensus 698 97.31
KOG4849|consensus 498 97.25
KOG4307|consensus944 97.16
KOG1456|consensus 494 97.01
KOG1996|consensus378 96.74
KOG4676|consensus 479 96.72
KOG2416|consensus 718 96.59
KOG2202|consensus260 96.37
KOG0106|consensus216 96.35
PF15023166 DUF4523: Protein of unknown function (DUF4523) 96.2
KOG0115|consensus 275 96.18
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.14
KOG4574|consensus 1007 95.97
KOG0129|consensus520 95.74
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.54
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.45
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 94.73
KOG0105|consensus241 94.66
KOG4307|consensus 944 94.6
KOG2068|consensus 327 94.2
KOG2591|consensus 684 94.01
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 93.8
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 93.44
KOG0112|consensus 975 93.17
KOG4660|consensus549 93.02
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 92.77
KOG0128|consensus881 92.64
KOG1365|consensus 508 92.24
KOG2253|consensus 668 91.44
KOG0804|consensus 493 91.24
smart0036170 RRM_1 RNA recognition motif. 90.81
KOG0125|consensus 376 90.73
KOG2135|consensus526 90.65
KOG4285|consensus350 89.25
KOG4410|consensus396 88.47
KOG4210|consensus285 87.41
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 87.21
KOG0149|consensus247 87.03
KOG0122|consensus270 86.35
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 86.19
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 85.24
KOG0107|consensus195 85.24
KOG4208|consensus214 85.11
>KOG0117|consensus Back     alignment and domain information
Probab=99.94  E-value=5.4e-26  Score=171.08  Aligned_cols=125  Identities=43%  Similarity=0.851  Sum_probs=118.7

Q ss_pred             CceEEEEeCCCCCCCHHHHHHHhhccCCeeEEEEe--------cCeEEEEECCHHHHHh---------------------
Q psy1185           3 KVKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRI--------KDYAFVHFEDRQEAIT---------------------   53 (131)
Q Consensus         3 ~~~~l~v~nLp~~~t~~~l~~~F~~~G~v~~~~i~--------~~~~fv~~~~~~~a~~---------------------   53 (131)
                      .-|.||||.||.++.|++|..||++.|+|.++++|        ||||||+|++.+.|+.                     
T Consensus        82 ~G~EVfvGkIPrD~~EdeLvplfEkiG~I~elRLMmD~~sG~nRGYAFVtf~~Ke~Aq~Aik~lnn~Eir~GK~igvc~S  161 (506)
T KOG0117|consen   82 RGCEVFVGKIPRDVFEDELVPLFEKIGKIYELRLMMDPFSGDNRGYAFVTFCTKEEAQEAIKELNNYEIRPGKLLGVCVS  161 (506)
T ss_pred             CCceEEecCCCccccchhhHHHHHhccceeeEEEeecccCCCCcceEEEEeecHHHHHHHHHHhhCccccCCCEeEEEEe
Confidence            35789999999999999999999999999999998        8999999999999988                     


Q ss_pred             ---------------------------hcCCceeEEecCCCCCCCCcceEEEEeCCHHhHHHHHHHHhCCcceecCcEEE
Q psy1185          54 ---------------------------VTGLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDII  106 (131)
Q Consensus        54 ---------------------------~~g~~~~~~~~~~~~~~~~~~~~fv~f~~~~~a~~a~~~l~~~~~~~~g~~l~  106 (131)
                                                 ..|+..++++..+....++||||||+|.+|..|..|.+.|-...+.++|..+.
T Consensus       162 van~RLFiG~IPK~k~keeIlee~~kVteGVvdVivy~~p~dk~KNRGFaFveYe~H~~Aa~aRrKl~~g~~klwgn~~t  241 (506)
T KOG0117|consen  162 VANCRLFIGNIPKTKKKEEILEEMKKVTEGVVDVIVYPSPDDKTKNRGFAFVEYESHRAAAMARRKLMPGKIKLWGNAIT  241 (506)
T ss_pred             eecceeEeccCCccccHHHHHHHHHhhCCCeeEEEEecCccccccccceEEEEeecchhHHHHHhhccCCceeecCCcce
Confidence                                       46899999999999999999999999999999999999998878999999999


Q ss_pred             EEecCCCCCCChHHHHhHhhh
Q psy1185         107 VDWADPQEEPDTETMSKVLML  127 (131)
Q Consensus       107 v~~a~~~~~~~~~~~~~~~~~  127 (131)
                      |+||.|+.+++.+.|+++|.|
T Consensus       242 VdWAep~~e~ded~ms~VKvL  262 (506)
T KOG0117|consen  242 VDWAEPEEEPDEDTMSKVKVL  262 (506)
T ss_pred             eeccCcccCCChhhhhheeee
Confidence            999999999999999999976



>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG4410|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
2dis_A109 Solution Structure Of The Rrm Domain Of Unnamed Pro 3e-16
2dgu_A103 Solution Structure Of The Rna Binding Domain In Het 2e-15
2dk2_A97 Solution Structure Of Rrm Domain In Heterogeneous N 5e-15
2cpd_A99 Solution Structure Of The Rna Recognition Motif Of 1e-11
2dnq_A90 Solution Structure Of Rna Binding Domain 1 In Rna-B 1e-06
2dgt_A92 Solution Structure Of The Second Rna Binding Domain 2e-06
2dnp_A90 Solution Structure Of Rna Binding Domain 2 In Rna-B 7e-06
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 1e-04
>pdb|2DIS|A Chain A, Solution Structure Of The Rrm Domain Of Unnamed Protein Product Length = 109 Back     alignment and structure

Iteration: 1

Score = 80.1 bits (196), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 32/69 (46%), Positives = 51/69 (73%) Query: 56 GLSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWADPQEE 115 G+ VI+Y+S D KNRGF F+EY+SH++A++A+++L GR+++WG I VDWA+P+ + Sbjct: 35 GVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEID 94 Query: 116 PDTETMSKV 124 D + M V Sbjct: 95 VDEDVMETV 103
>pdb|2DGU|A Chain A, Solution Structure Of The Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein Q Length = 103 Back     alignment and structure
>pdb|2DK2|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleoprotein R (Hnrnp R) Length = 97 Back     alignment and structure
>pdb|2CPD|A Chain A, Solution Structure Of The Rna Recognition Motif Of Human Apobec-1 Complementation Factor, Acf Length = 99 Back     alignment and structure
>pdb|2DNQ|A Chain A, Solution Structure Of Rna Binding Domain 1 In Rna-Binding Protein 30 Length = 90 Back     alignment and structure
>pdb|2DGT|A Chain A, Solution Structure Of The Second Rna Binding Domain In Rna- Binding Protein 30 Length = 92 Back     alignment and structure
>pdb|2DNP|A Chain A, Solution Structure Of Rna Binding Domain 2 In Rna-Binding Protein 14 Length = 90 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
2dis_A109 Unnamed protein product; structural genomics, RRM 7e-31
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 7e-25
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 5e-23
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-22
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 5e-12
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-19
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-13
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 3e-19
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 8e-19
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-18
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 2e-17
2cpj_A99 Non-POU domain-containing octamer-binding protein; 5e-17
2cph_A107 RNA binding motif protein 19; RNA recognition moti 9e-17
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-15
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 4e-15
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 4e-15
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 5e-15
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 1e-14
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-14
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-14
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-09
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 4e-14
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-14
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 7e-10
3q2s_C229 Cleavage and polyadenylation specificity factor S; 5e-14
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-14
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 6e-14
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 8e-14
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 8e-14
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 9e-14
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 1e-13
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-13
1x4e_A85 RNA binding motif, single-stranded interacting pro 3e-13
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 3e-13
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 4e-13
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 4e-13
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 4e-13
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 6e-13
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-13
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 6e-13
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 7e-13
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 7e-13
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 8e-13
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 8e-13
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-13
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-12
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-12
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-12
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-12
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 1e-12
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-12
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-12
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 2e-12
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-12
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-12
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-12
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-07
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 3e-12
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-12
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 4e-12
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 4e-12
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 5e-12
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 5e-12
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 6e-12
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 7e-12
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 8e-12
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 1e-11
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-11
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-11
2kt5_A124 RNA and export factor-binding protein 2; chaperone 1e-11
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 1e-11
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 1e-11
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-11
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 6e-11
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-11
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-10
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-11
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-11
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 5e-10
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 2e-11
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-11
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 2e-11
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-11
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-11
3p5t_L90 Cleavage and polyadenylation specificity factor S; 2e-11
2i2y_A150 Fusion protein consists of immunoglobin G- binding 2e-11
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 3e-11
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-11
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-11
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 3e-11
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-11
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 9e-10
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 4e-11
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 5e-11
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 5e-11
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 5e-11
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 5e-11
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 4e-07
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 6e-11
2f3j_A177 RNA and export factor binding protein 2; RRM domai 7e-11
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 1e-10
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 1e-10
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-10
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-08
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-10
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-10
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-10
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-10
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-10
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-10
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 2e-10
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 3e-10
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 3e-10
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 3e-09
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 3e-10
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 3e-10
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 4e-10
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 4e-10
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 5e-10
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-10
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-07
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 6e-10
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 7e-10
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 9e-10
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 1e-09
1x5p_A97 Negative elongation factor E; structure genomics, 1e-09
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 1e-09
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 1e-09
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 1e-09
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 1e-09
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 1e-09
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-09
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 3e-09
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-09
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-08
2cqd_A116 RNA-binding region containing protein 1; RNA recog 3e-09
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-09
2div_A99 TRNA selenocysteine associated protein; structural 4e-09
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 4e-09
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-08
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 1e-08
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 1e-08
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 2e-08
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 2e-08
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 3e-08
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 4e-08
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 4e-08
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 5e-08
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 5e-08
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 5e-08
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 6e-08
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 6e-08
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 9e-08
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 1e-07
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-07
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 3e-07
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 3e-07
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-07
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 4e-07
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 4e-07
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 5e-07
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 6e-07
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 6e-07
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 7e-07
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 8e-07
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 9e-07
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1e-06
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 1e-06
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 1e-06
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 1e-06
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 1e-06
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 2e-06
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-06
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 3e-06
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 4e-06
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 5e-06
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 7e-06
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 1e-05
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 3e-05
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 3e-05
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 6e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 2e-04
2krb_A81 Eukaryotic translation initiation factor 3 subunit 2e-04
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 2e-04
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 6e-04
2dnl_A114 Cytoplasmic polyadenylation element binding protei 8e-04
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
 Score =  105 bits (264), Expect = 7e-31
 Identities = 35/118 (29%), Positives = 61/118 (51%), Gaps = 25/118 (21%)

Query: 7   LYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITVTGLSQVIIYSSP 66
           L++  + +    E++ E   +                            G+  VI+Y+S 
Sbjct: 11  LFIGGIPKMKKREEILEEIAKVT-------------------------EGVLDVIVYASA 45

Query: 67  DDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWADPQEEPDTETMSKV 124
            D  KNRGF F+EY+SH++A++A+++L  GR+++WG  I VDWA+P+ + D + M  V
Sbjct: 46  ADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETV 103


>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.92
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.91
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.91
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.91
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.9
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.9
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.9
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.9
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.89
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.89
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.89
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.89
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.88
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.88
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.88
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.88
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.88
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.87
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.87
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.87
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.87
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.87
2dis_A109 Unnamed protein product; structural genomics, RRM 99.87
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.86
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.86
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.86
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.86
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.86
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.86
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.86
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.86
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.86
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.86
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.86
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.86
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.86
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.86
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.86
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.86
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.86
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.85
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.85
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.85
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.85
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.85
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.85
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.85
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.85
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.85
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.85
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.85
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.85
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.85
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.85
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.85
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.85
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.85
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.85
2div_A99 TRNA selenocysteine associated protein; structural 99.85
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.85
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.85
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.85
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.84
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.84
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.84
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.84
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.84
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.84
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.84
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.84
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.84
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.84
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.84
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.84
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.84
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.84
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.84
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.84
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.83
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.83
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.83
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.83
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.83
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.83
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.83
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.83
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.83
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.83
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.83
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.83
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.83
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.83
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.83
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.83
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.83
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.83
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.83
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.83
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.83
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.83
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.83
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.83
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.83
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.83
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.82
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.82
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.82
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.82
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.82
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.82
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.82
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.82
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.82
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.82
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.82
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.82
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.82
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.82
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.82
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.82
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.82
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.82
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.82
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.81
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.81
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.81
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.81
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.81
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.81
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.81
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.81
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.81
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.81
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.81
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.81
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.8
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.8
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.8
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.8
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.79
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.79
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.79
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.79
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.79
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.79
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.79
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.78
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.78
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.78
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.78
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.78
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.78
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.78
1x5p_A97 Negative elongation factor E; structure genomics, 99.77
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.77
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.77
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.64
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.77
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.77
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.77
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.77
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.76
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.76
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.76
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.76
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.76
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.75
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.75
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.75
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.74
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.73
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.73
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.73
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.73
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.72
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.72
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.72
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.71
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.71
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.71
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.67
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.67
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.65
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.61
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.57
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.53
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.53
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.51
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.49
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.41
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.39
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.25
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.24
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.24
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.21
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.21
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.19
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.18
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.18
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.18
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.17
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.16
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.09
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.09
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.08
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.02
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.0
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.91
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.5
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.97
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.64
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.61
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.24
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.16
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.13
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.72
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.51
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 95.79
2i2y_A150 Fusion protein consists of immunoglobin G- binding 95.05
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 95.0
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 93.4
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 93.36
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 93.26
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 93.0
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 92.78
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 92.66
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 92.64
2krb_A81 Eukaryotic translation initiation factor 3 subunit 92.29
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 92.23
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 92.02
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 91.95
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 91.76
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 91.71
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 91.64
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 91.52
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 91.44
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 91.33
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 91.05
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 91.05
1x4e_A85 RNA binding motif, single-stranded interacting pro 91.01
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 90.93
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 90.77
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 90.71
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 90.68
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 90.56
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 90.5
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 90.46
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 90.46
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 90.45
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 90.36
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 90.35
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 90.34
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 90.32
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 90.3
3p5t_L90 Cleavage and polyadenylation specificity factor S; 90.28
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 90.14
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 90.07
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 90.03
2dis_A109 Unnamed protein product; structural genomics, RRM 90.0
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 90.0
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 89.94
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 89.92
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 89.87
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 89.69
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 89.64
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 89.59
2dnl_A114 Cytoplasmic polyadenylation element binding protei 89.58
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 89.52
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 89.52
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 89.49
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 89.45
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 89.43
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 89.41
2cph_A107 RNA binding motif protein 19; RNA recognition moti 89.4
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 89.37
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 89.37
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 89.35
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 89.29
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 89.24
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 89.23
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 89.18
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 89.11
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 89.09
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 89.04
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 88.99
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 88.99
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 88.94
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 88.8
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 88.79
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 88.79
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 88.78
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 88.77
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 88.69
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 88.65
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 88.64
2la6_A99 RNA-binding protein FUS; structural genomics, nort 88.61
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 88.61
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 88.59
2div_A99 TRNA selenocysteine associated protein; structural 88.56
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 88.54
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 88.52
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 88.5
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 88.47
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 88.44
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 88.44
2cqd_A116 RNA-binding region containing protein 1; RNA recog 88.39
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 88.38
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 88.28
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 88.17
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 88.14
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 88.13
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 88.11
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 88.11
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 88.09
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 87.89
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 87.88
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 87.7
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 87.68
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 87.55
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 87.49
2dit_A112 HIV TAT specific factor 1 variant; structural geno 87.35
3n9u_C156 Cleavage and polyadenylation specificity factor S; 87.18
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 87.03
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 86.87
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 86.8
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 86.79
2kt5_A124 RNA and export factor-binding protein 2; chaperone 86.72
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 86.57
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 86.43
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 86.35
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 86.34
1x5o_A114 RNA binding motif, single-stranded interacting pro 86.34
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 86.25
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 85.69
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 85.16
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 85.06
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 84.57
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 84.27
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 84.12
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 83.59
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 83.43
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 83.37
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 82.99
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 82.68
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 82.38
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 82.33
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 82.3
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 81.51
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 81.2
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 80.63
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 80.55
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 80.45
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
Probab=99.92  E-value=3.6e-25  Score=155.54  Aligned_cols=109  Identities=20%  Similarity=0.370  Sum_probs=93.2

Q ss_pred             ceEEEEeCCCCCCCHHHHHHHhhccCCeeEEEEe--------cCeEEEEECCHHHHHh----------------------
Q psy1185           4 VKVLYVRNLTQYCTEEKLKEAFEQYGRVERVKRI--------KDYAFVHFEDRQEAIT----------------------   53 (131)
Q Consensus         4 ~~~l~v~nLp~~~t~~~l~~~F~~~G~v~~~~i~--------~~~~fv~~~~~~~a~~----------------------   53 (131)
                      .++|||||||+++++++|+++|++||+|.+++++        +|||||+|.+.++|+.                      
T Consensus        15 ~~tlfVgnLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~~G~afV~F~~~~~A~~Ai~~~~~~~~~g~~i~~~~~~~   94 (213)
T 4f02_A           15 MASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQR   94 (213)
T ss_dssp             CCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECCC
T ss_pred             CcEEEEeCCCCCCCHHHHHHHHHhhCCEEEEEEecccCCCCccccccceeCCHHHHHHHHHHhhhhhcCCcccccccccc
Confidence            5799999999999999999999999999999987        5899999999999998                      


Q ss_pred             -------------------------------hcC-CceeEEecCCCCCCCCcceEEEEeCCHHhHHHHHHHHhCCcceec
Q psy1185          54 -------------------------------VTG-LSQVIIYSSPDDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVW  101 (131)
Q Consensus        54 -------------------------------~~g-~~~~~~~~~~~~~~~~~~~~fv~f~~~~~a~~a~~~l~~~~~~~~  101 (131)
                                                     .+| +..+.+..+   .+.++|||||+|.+.++|.+|++.|||.  .++
T Consensus        95 ~~~~~~~~~~~l~v~nl~~~~t~~~l~~~F~~~G~i~~~~i~~d---~~~~~g~~fV~f~~~~~a~~Ai~~lng~--~~~  169 (213)
T 4f02_A           95 DPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCD---ENGSKGYGFVHFETQEAAERAIEKMNGM--LLN  169 (213)
T ss_dssp             CTHHHHHCTTEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEEE---TTEEEEEEEEEESSHHHHHHHHHHHTTC--EET
T ss_pred             cccccccccccceECCcccccHHHHHHHHHhhcCCeEEEEeecc---CCCCceEEEEEeCCHHHHHHHHHHhCCC--EEC
Confidence                                           234 333333332   3457899999999999999999999998  899


Q ss_pred             CcEEEEEecCCCCCCC
Q psy1185         102 GCDIIVDWADPQEEPD  117 (131)
Q Consensus       102 g~~l~v~~a~~~~~~~  117 (131)
                      |+.|.|.||.++.++.
T Consensus       170 g~~i~V~~a~~~~~~~  185 (213)
T 4f02_A          170 DRKVFVGRFKSRKERE  185 (213)
T ss_dssp             TEECEEEECCCHHHHH
T ss_pred             CEEEEEEEcCCCcccc
Confidence            9999999999765443



>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 131
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-19
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 7e-12
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-11
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 5e-10
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 2e-09
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 4e-09
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 5e-09
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 1e-08
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 6e-08
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 7e-08
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 7e-08
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-07
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-07
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-07
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-07
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-07
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-07
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 5e-07
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 5e-07
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 5e-07
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 5e-07
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 6e-07
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-07
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 8e-07
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-06
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-06
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 2e-06
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-06
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 4e-06
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 6e-06
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 6e-06
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 6e-06
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 1e-05
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 1e-05
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 1e-05
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-05
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-05
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 2e-05
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 3e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 5e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 5e-05
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 6e-05
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 7e-05
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 7e-05
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8e-05
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 9e-05
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 9e-05
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-04
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 1e-04
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 1e-04
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-04
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 3e-04
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 4e-04
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 4e-04
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 6e-04
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 0.001
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 0.001
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 0.001
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 0.002
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 0.002
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 0.002
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 0.004
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 0.004
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Hypothetical protein FLJ20273
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 75.1 bits (184), Expect = 2e-19
 Identities = 34/118 (28%), Positives = 59/118 (50%), Gaps = 25/118 (21%)

Query: 7   LYVRNLTQYCTEEKLKEAFEQYGRVERVKRIKDYAFVHFEDRQEAITVTGLSQVIIYSSP 66
           L++  + +    E++ E   +                                VI+Y+S 
Sbjct: 4   LFIGGIPKMKKREEILEEIAKVTEGVL-------------------------DVIVYASA 38

Query: 67  DDNKKNRGFCFLEYDSHKSASLAKKRLATGRLKVWGCDIIVDWADPQEEPDTETMSKV 124
            D  KNRGF F+EY+SH++A++A+++L  GR+++WG  I VDWA+P+ + D + M  V
Sbjct: 39  ADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETV 96


>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.91
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.91
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.91
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.91
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.91
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.9
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.9
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.9
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.9
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.89
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.89
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.89
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.89
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.89
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.89
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.89
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.89
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.89
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.89
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.88
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.88
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.88
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.88
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.88
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.88
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.88
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.88
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.88
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.87
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.87
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.87
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.87
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.87
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.87
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.87
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.87
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.86
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.86
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.86
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.86
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.86
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.86
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.86
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.86
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.85
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.85
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.85
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.84
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.84
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.84
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.84
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.84
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.84
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.84
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.83
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.83
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.83
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.83
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.83
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.83
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.83
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.82
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.82
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.82
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.82
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.82
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.81
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.81
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.8
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.8
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.8
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.8
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.8
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.79
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.77
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.76
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.76
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.76
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.71
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.7
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.68
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.63
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.62
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.59
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.54
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.34
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.25
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.72
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.53
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.46
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 94.92
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 94.17
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 93.85
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 93.62
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 93.6
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 93.46
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 93.39
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 93.28
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 93.08
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 93.04
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 92.84
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 92.84
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 92.81
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 92.81
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 92.68
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 92.68
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 92.52
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 92.51
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 92.49
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 92.47
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 92.4
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 92.23
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 92.13
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 91.88
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 91.7
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 91.66
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 91.66
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 91.62
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 91.5
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 91.46
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 91.42
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 91.38
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 91.36
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 91.32
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 91.21
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 91.16
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 91.13
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 91.12
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 91.09
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 91.03
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 90.92
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 90.92
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 90.72
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 90.54
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 90.37
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 90.35
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 90.33
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 90.33
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 90.24
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 90.21
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 90.18
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 90.08
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 90.06
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 90.01
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 89.91
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 89.9
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 89.77
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 89.76
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 88.97
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 88.79
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 88.43
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 87.93
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 87.66
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 87.42
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 86.84
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 86.28
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 85.59
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 82.24
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 82.19
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Hypothetical protein FLJ20273
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=6e-25  Score=135.67  Aligned_cols=95  Identities=34%  Similarity=0.672  Sum_probs=83.9

Q ss_pred             ceEEEEeCCCCCCCHHHHHHHhhccCC-eeEEEEecCeEEEEECCHHHHHhhcCCceeEEecCCCCCCCCcceEEEEeCC
Q psy1185           4 VKVLYVRNLTQYCTEEKLKEAFEQYGR-VERVKRIKDYAFVHFEDRQEAITVTGLSQVIIYSSPDDNKKNRGFCFLEYDS   82 (131)
Q Consensus         4 ~~~l~v~nLp~~~t~~~l~~~F~~~G~-v~~~~i~~~~~fv~~~~~~~a~~~~g~~~~~~~~~~~~~~~~~~~~fv~f~~   82 (131)
                      .|+|||||||.++++++|+++|++||+ |.++.+++.                          +...+.++|||||+|.+
T Consensus         1 n~rLyV~nLp~~~te~~l~~~f~~~g~~i~~v~~~~~--------------------------~~~~~~~rg~aFV~F~~   54 (96)
T d2disa1           1 NCRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYAS--------------------------AADKMKNRGFAFVEYES   54 (96)
T ss_dssp             SEEEEEECCCTTSCHHHHHHHHHHHSTTEEEEECCSS--------------------------SCTTTTTCCEEEEEESS
T ss_pred             CCEEEEcCCCCcCCHHHHHHHHHHhCCcceEEEEeee--------------------------ccccccCCCeEEEEEcC
Confidence            478999999999999999999999996 888877642                          23467889999999999


Q ss_pred             HHhHHHHHHHHhCCcceecCcEEEEEecCCCCCCChHHHHhH
Q psy1185          83 HKSASLAKKRLATGRLKVWGCDIIVDWADPQEEPDTETMSKV  124 (131)
Q Consensus        83 ~~~a~~a~~~l~~~~~~~~g~~l~v~~a~~~~~~~~~~~~~~  124 (131)
                      +++|.+|++.|++..+.++|+.|.|+||+|+.+++.+.|+++
T Consensus        55 ~~~A~~Ai~~l~~~~~~~~g~~i~V~~A~p~~~~~~~~~~~v   96 (96)
T d2disa1          55 HRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETV   96 (96)
T ss_dssp             HHHHHHHHTTTTTCCSCBTTBCCEEEESCSSCSTTTCCSSCC
T ss_pred             HHHHHHHHHHHcCCCeEECCEEEEEEEcCCCCCCChHHhccC
Confidence            999999999998877788999999999999999998888764



>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure