Diaphorina citri psyllid: psy11862

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--

MGDVARWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRKECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKENVAANTRGTQRLLDIALKMKKLVVSLDIG

cccHHHHccccEEEEEccccHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHccHHHHHHHHHcccccccEEEEEcccccccccccHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEc

*GDVARWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRKECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKENVAANTRGTQRLLDIALKMKKLVVSLDIG

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGDVARWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRKECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKENVAANTRGTQRLLDIALKMKKLVVSLDIG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Putative fatty acyl-CoA reductase CG5065	Catalyzes the reduction of saturated fatty acyl-CoA to fatty alcohols.	confident	A1ZAI5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044710 [BP]	single-organism metabolic process	probable	GO:0008150, GO:0008152
GO:0080019 [MF]	fatty-acyl-CoA reductase (alcohol-forming) activity	probable	GO:0003824, GO:0016903, GO:0003674, GO:0016620, GO:0016491
GO:0050062 [MF]	long-chain-fatty-acyl-CoA reductase activity	probable	GO:0003824, GO:0016903, GO:0003674, GO:0016620, GO:0016491
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DQV, chain A
Confidence level:very confident
Coverage over the Query: 7-152
View the alignment between query and template
View the model in PyMOL