Diaphorina citri psyllid: psy11864


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190---
VALKFQSFEIENHDQCTYDYVEIRDGHAPDSPIIGTYCGYKLPPDIKSSGTKLMIKFVSDGSVQKPGFSAIFMKEFDECALEDHGCEHTCKNILGGYECSCKIGYELHSDGKICLDACGGILNTPNGTLTSPSFPDLYIKNKTCIWEIVAPPQYRISLNFTHFDIEGNNLFQSSCEYDNLTVFSKIGDSFKSQ
cEEEEEEEEECccccccccEEEEEccccccccCEEEEccccccccEEEcccEEEEEEEEccccccccEEEEEEEECcccccccccccccEEEccccEEEEECccEEEccccccCCcccccEEEccccEEEcccccccccccccEEEEEEcccccEEEEEEEEEEECccccccccccccEEEEEcccccccccc
VALKFQSFEIENHDQCTYDYVEIRDGHAPDSPIIGTYCGYKLPPDIKSSGTKLMIKFVSDGSVQKPGFSAIFMKEFDECALEDHGCEHTCKNILGGYECSCKIGYELHSDGKICLDACGGILNTPNGTLTSPSFPDLYIKNKTCIWEIVAPPQYRISLNFTHFDIEGNNLFQSSCEYDNLTVFSKI*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VALKFQSFEIENHDQCTYDYVEIRDGHAPDSPIIGTYCGYKLPPDIKSSGTKLMIKFVSDGSVQKPGFSAIFMKEFDECALEDHGCEHTCKNILGGYECSCKIGYELHSDGKICLDACGGILNTPNGTLTSPSFPDLYIKNKTCIWEIVAPPQYRISLNFTHFDIEGNNLFQSSCEYDNLTVFSKIGDSFKSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bone morphogenetic protein 1 homolog confidentP98069
Tolloid-like protein 2 Protease which specifically processes pro-lysyl oxidase. Required for the embryonic development. Predominant protease, which in the development, influences dorsal-ventral patterning and skeletogenesis.confidentQ9Y6L7
Tolloid-like protein 2 Protease which specifically processes pro-lysyl oxidase. Required for the embryonic development. Predominant protease, which in the development, influences dorsal-ventral patterning and skeletogenesis.confidentQ9WVM6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0004252 [MF]serine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0004222 [MF]metalloendopeptidase activityprobableGO:0016787, GO:0004175, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008237
GO:0010629 [BP]negative regulation of gene expressionprobableGO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0005518 [MF]collagen bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0061036 [BP]positive regulation of cartilage developmentprobableGO:0051094, GO:0050793, GO:0008150, GO:0061035, GO:2000026, GO:0051239, GO:0048518, GO:0065007, GO:0050789
GO:0048583 [BP]regulation of response to stimulusprobableGO:0008150, GO:0065007, GO:0050789
GO:0035107 [BP]appendage morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048736, GO:0009653, GO:0007275, GO:0044699
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0016485 [BP]protein processingprobableGO:0044238, GO:0051604, GO:0019538, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KQ4, chain B
Confidence level:very confident
Coverage over the Query: 1-75,115-190
View the alignment between query and template
View the model in PyMOL
Template: 3DEM, chain A
Confidence level:very confident
Coverage over the Query: 1-187
View the alignment between query and template
View the model in PyMOL