Psyllid ID: psy11864
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 193 | ||||||
| 307169336 | 1051 | Tolloid-like protein 2 [Camponotus flori | 0.911 | 0.167 | 0.765 | 1e-84 | |
| 332021857 | 1224 | Tolloid-like protein 2 [Acromyrmex echin | 0.911 | 0.143 | 0.755 | 2e-84 | |
| 345495274 | 1135 | PREDICTED: tolloid-like protein 2-like [ | 0.875 | 0.148 | 0.755 | 5e-84 | |
| 307193271 | 1238 | Tolloid-like protein 2 [Harpegnathos sal | 0.880 | 0.137 | 0.734 | 2e-82 | |
| 340722615 | 1233 | PREDICTED: tolloid-like protein 2-like [ | 0.922 | 0.144 | 0.736 | 4e-82 | |
| 350424355 | 1086 | PREDICTED: tolloid-like protein 2-like [ | 0.922 | 0.163 | 0.736 | 7e-82 | |
| 328787501 | 1232 | PREDICTED: tolkin [Apis mellifera] | 0.854 | 0.133 | 0.744 | 9e-82 | |
| 383851625 | 1225 | PREDICTED: tolloid-like protein 2-like [ | 0.891 | 0.140 | 0.744 | 1e-81 | |
| 380022873 | 914 | PREDICTED: LOW QUALITY PROTEIN: tolloid- | 0.891 | 0.188 | 0.744 | 4e-81 | |
| 242023390 | 914 | conserved hypothetical protein [Pediculu | 0.891 | 0.188 | 0.731 | 1e-80 |
| >gi|307169336|gb|EFN62057.1| Tolloid-like protein 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 318 bits (814), Expect = 1e-84, Method: Compositional matrix adjust.
Identities = 144/188 (76%), Positives = 159/188 (84%)
Query: 1 VALKFQSFEIENHDQCTYDYVEIRDGHAPDSPIIGTYCGYKLPPDIKSSGTKLMIKFVSD 60
VALKFQSFEIENHD C YDYVE+RDGH DSP+IG YCGYK+PPDIKS G KL++KFVSD
Sbjct: 525 VALKFQSFEIENHDNCVYDYVEVRDGHDNDSPLIGVYCGYKIPPDIKSVGNKLLVKFVSD 584
Query: 61 GSVQKPGFSAIFMKEFDECALEDHGCEHTCKNILGGYECSCKIGYELHSDGKICLDACGG 120
GSVQK GFSA FMKEFDEC L DHGCEH C N LGGYECSCKIGYELHSDGK C DACGG
Sbjct: 585 GSVQKAGFSATFMKEFDECILTDHGCEHNCTNTLGGYECSCKIGYELHSDGKHCEDACGG 644
Query: 121 ILNTPNGTLTSPSFPDLYIKNKTCIWEIVAPPQYRISLNFTHFDIEGNNLFQSSCEYDNL 180
N NGT+TSPSFP+ Y NK C+WEIVAP QYRI+LNFTHFD+EGNN++Q CEYD++
Sbjct: 645 FFNGSNGTITSPSFPEAYPGNKNCVWEIVAPSQYRITLNFTHFDLEGNNVYQEECEYDSV 704
Query: 181 TVFSKIGD 188
V SK+GD
Sbjct: 705 EVASKLGD 712
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332021857|gb|EGI62193.1| Tolloid-like protein 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|345495274|ref|XP_003427473.1| PREDICTED: tolloid-like protein 2-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307193271|gb|EFN76162.1| Tolloid-like protein 2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|340722615|ref|XP_003399699.1| PREDICTED: tolloid-like protein 2-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350424355|ref|XP_003493768.1| PREDICTED: tolloid-like protein 2-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|328787501|ref|XP_393866.3| PREDICTED: tolkin [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383851625|ref|XP_003701332.1| PREDICTED: tolloid-like protein 2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380022873|ref|XP_003695260.1| PREDICTED: LOW QUALITY PROTEIN: tolloid-like protein 2-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|242023390|ref|XP_002432117.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212517491|gb|EEB19379.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 193 | ||||||
| FB|FBgn0004885 | 1464 | tok "tolkin" [Drosophila melan | 0.979 | 0.129 | 0.677 | 8.9e-73 | |
| FB|FBgn0003719 | 1067 | tld "tolloid" [Drosophila mela | 0.979 | 0.177 | 0.554 | 7.8e-60 | |
| UNIPROTKB|Q9Y6L7 | 1015 | TLL2 "Tolloid-like protein 2" | 0.968 | 0.184 | 0.536 | 3.5e-54 | |
| UNIPROTKB|F1MF35 | 893 | TLL2 "Uncharacterized protein" | 0.932 | 0.201 | 0.551 | 1.7e-53 | |
| UNIPROTKB|Q8JI28 | 1007 | tll1 "Tolloid-like protein 1" | 0.968 | 0.185 | 0.531 | 4.1e-53 | |
| MGI|MGI:1346044 | 1012 | Tll2 "tolloid-like 2" [Mus mus | 0.968 | 0.184 | 0.541 | 4.2e-53 | |
| UNIPROTKB|F1SBG0 | 894 | TLL2 "Uncharacterized protein" | 0.932 | 0.201 | 0.545 | 8e-53 | |
| UNIPROTKB|F1PGC4 | 858 | BMP1 "Uncharacterized protein" | 0.958 | 0.215 | 0.544 | 1.3e-52 | |
| UNIPROTKB|F1PE27 | 567 | TLL2 "Uncharacterized protein" | 0.880 | 0.299 | 0.561 | 1.3e-52 | |
| UNIPROTKB|O43897 | 1013 | TLL1 "Tolloid-like protein 1" | 0.968 | 0.184 | 0.520 | 1.5e-52 |
| FB|FBgn0004885 tok "tolkin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 746 (267.7 bits), Expect = 8.9e-73, P = 8.9e-73
Identities = 128/189 (67%), Positives = 156/189 (82%)
Query: 1 VALKFQSFEIENHDQCTYDYVEIRDGHAPDSPIIGTYCGYKLPPDIKSSGTKLMIKFVSD 60
VALKFQSFE+ENHD C YDYVE+RDG D+P+IG +CGYK PP++KSSG + +KFVSD
Sbjct: 880 VALKFQSFEVENHDSCVYDYVEVRDGPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSD 939
Query: 61 GSVQKPGFSAIFMKEFDECALEDHGCEHTCKNILGGYECSCKIGYELHSDGKICLDACGG 120
SVQK GFSA+FMKE DEC ++HGCEH C N LGGYECSC+IG+ELHSD K C DACGG
Sbjct: 940 TSVQKAGFSAVFMKEVDECETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGG 999
Query: 121 ILNTPNGTLTSPSFPDLYIKNKTCIWEIVAPPQYRISLNFTHFDIEGNNLFQSSCEYDNL 180
++ PNGT+TSPSFP++Y K CIWEIVAPP++RISLNFTHFD+EG QS C YD++
Sbjct: 1000 VIEYPNGTITSPSFPEMYPLLKECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSV 1059
Query: 181 TVFSKIGDS 189
TV+SK+G++
Sbjct: 1060 TVYSKLGEN 1068
|
|
| FB|FBgn0003719 tld "tolloid" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y6L7 TLL2 "Tolloid-like protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MF35 TLL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8JI28 tll1 "Tolloid-like protein 1" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1346044 Tll2 "tolloid-like 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SBG0 TLL2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PGC4 BMP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PE27 TLL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43897 TLL1 "Tolloid-like protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 193 | |||
| pfam00431 | 110 | pfam00431, CUB, CUB domain | 2e-27 | |
| cd00041 | 113 | cd00041, CUB, CUB domain; extracellular domain; pr | 1e-25 | |
| smart00042 | 102 | smart00042, CUB, Domain first found in C1r, C1s, u | 2e-24 | |
| cd00041 | 113 | cd00041, CUB, CUB domain; extracellular domain; pr | 5e-19 | |
| pfam00431 | 110 | pfam00431, CUB, CUB domain | 6e-18 | |
| smart00042 | 102 | smart00042, CUB, Domain first found in C1r, C1s, u | 9e-17 | |
| cd01475 | 224 | cd01475, vWA_Matrilin, VWA_Matrilin: In cartilagin | 5e-06 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 4e-05 | |
| pfam07645 | 42 | pfam07645, EGF_CA, Calcium-binding EGF domain | 8e-05 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 3e-04 | |
| pfam12662 | 24 | pfam12662, cEGF, Complement Clr-like EGF-like | 0.001 | |
| pfam12947 | 36 | pfam12947, EGF_3, EGF domain | 0.002 |
| >gnl|CDD|215916 pfam00431, CUB, CUB domain | Back alignment and domain information |
|---|
Score = 99.7 bits (249), Expect = 2e-27
Identities = 37/72 (51%), Positives = 52/72 (72%)
Query: 1 VALKFQSFEIENHDQCTYDYVEIRDGHAPDSPIIGTYCGYKLPPDIKSSGTKLMIKFVSD 60
++L FQ F++E+HD+C YDYVEIRDG SP++G +CG P DI+S+ ++ IKFVSD
Sbjct: 39 ISLTFQDFDLEDHDECGYDYVEIRDGLPSSSPLLGRFCGSGPPEDIRSTSNQMTIKFVSD 98
Query: 61 GSVQKPGFSAIF 72
S+ K GF A +
Sbjct: 99 SSISKRGFKATY 110
|
Length = 110 |
| >gnl|CDD|238001 cd00041, CUB, CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast | Back alignment and domain information |
|---|
| >gnl|CDD|214483 smart00042, CUB, Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein | Back alignment and domain information |
|---|
| >gnl|CDD|238001 cd00041, CUB, CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast | Back alignment and domain information |
|---|
| >gnl|CDD|215916 pfam00431, CUB, CUB domain | Back alignment and domain information |
|---|
| >gnl|CDD|214483 smart00042, CUB, Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein | Back alignment and domain information |
|---|
| >gnl|CDD|238752 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|221695 pfam12662, cEGF, Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >gnl|CDD|205157 pfam12947, EGF_3, EGF domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| PF00431 | 110 | CUB: CUB domain CUB domain entry Spermadhesins fam | 99.75 | |
| cd00041 | 113 | CUB CUB domain; extracellular domain; present in p | 99.74 | |
| smart00042 | 102 | CUB Domain first found in C1r, C1s, uEGF, and bone | 99.71 | |
| KOG4586|consensus | 156 | 99.64 | ||
| PF00431 | 110 | CUB: CUB domain CUB domain entry Spermadhesins fam | 99.54 | |
| cd00041 | 113 | CUB CUB domain; extracellular domain; present in p | 99.51 | |
| smart00042 | 102 | CUB Domain first found in C1r, C1s, uEGF, and bone | 99.5 | |
| KOG4292|consensus | 454 | 99.43 | ||
| KOG4586|consensus | 156 | 99.1 | ||
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 98.59 | |
| KOG4292|consensus | 454 | 98.16 | ||
| PF05428 | 311 | CRF-BP: Corticotropin-releasing factor binding pro | 98.09 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 97.76 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 97.25 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 96.2 | |
| PF02408 | 120 | CUB_2: CUB-like domain; InterPro: IPR003366 This d | 96.19 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 94.71 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 92.99 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 92.35 | |
| PF05428 | 311 | CRF-BP: Corticotropin-releasing factor binding pro | 91.78 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 87.45 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 84.69 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 83.02 | |
| KOG4289|consensus | 2531 | 81.5 | ||
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 81.34 |
| >PF00431 CUB: CUB domain CUB domain entry Spermadhesins family entry Link to schematic domain picture by Peer Bork | Back alignment and domain information |
|---|
Probab=99.75 E-value=1.4e-18 Score=113.56 Aligned_cols=68 Identities=43% Similarity=0.870 Sum_probs=60.1
Q ss_pred CCCCcccCCCCccCCCCCCCCCCCCceEEEEEcCCCCeEEEEEeeEEeecCCCCCCCCCCcEEEEEeCCCCc
Q psy11864 118 CGGILNTPNGTLTSPSFPDLYIKNKTCIWEIVAPPQYRISLNFTHFDIEGNNLFQSSCEYDNLTVFSKIGDS 189 (193)
Q Consensus 118 C~~~~~~~~g~i~Sp~~p~~y~~~~~C~w~I~~~~~~~i~l~F~~f~l~~~~~~~~~C~~D~l~I~dg~~~~ 189 (193)
||+.+...+|.|+||+||..|+++.+|.|.|+++++++|.|+|..|+|+... .|..|+|+|+||.+..
T Consensus 1 Cg~~~~~~~g~i~Sp~yp~~y~~~~~C~w~i~~~~~~~I~l~f~~~~~~~~~----~c~~d~l~v~~g~~~~ 68 (110)
T PF00431_consen 1 CGGRLTNNSGIISSPNYPSNYPSNSDCTWTITAPPGHRIRLTFLSFDLESSD----SCCQDYLEVYDGNDES 68 (110)
T ss_dssp SEEEECSSEEEEESTTTTS-SSSSEEEEEEEE-STTEEEEEEEEEEEB--TT----TSTSSEEEEESSSSTT
T ss_pred CcCEEECCeEEEECCCCCCCCCCCCcEeEEEEecccceeeeccccccceeee----eecccceeEEeecccc
Confidence 7778888999999999999999999999999999999999999999999876 7989999999999865
|
; InterPro: IPR000859 The CUB domain (for complement C1r/C1s, Uegf, Bmp1) is a structural motif of approximately 110 residues found almost exclusively in extracellular and plasma membrane-associated proteins, many of which are developmentally regulated [, ]. These proteins are involved in a diverse range of functions, including complement activation, developmental patterning, tissue repair, axon guidance and angiogenesis, cell signalling, fertilisation, haemostasis, inflammation, neurotransmission, receptor-mediated endocytosis, and tumour suppression [, ]. Many CUB-containing proteins are peptidases belonging to MEROPS peptidase families M12A (astacin) and S1A (chymotrypsin). Proteins containing a CUB domain include: Mammalian complement subcomponents C1s/C1r, which form the calcium-dependent complex C1, the first component of the classical pathway of the complement system. Cricetidae sp. (Hamster) serine protease Casp, which degrades type I and IV collagen and fibronectin in the presence of calcium. Mammalian complement-activating component of Ra-reactive factor (RARF), a protease that cleaves the C4 component of complement. Vertebrate enteropeptidase (3.4.21.9 from EC), a type II membrane protein of the intestinal brush border, which activates trypsinogen. Vertebrate bone morphogenic protein 1 (BMP-1), a protein which induces cartilage and bone formation and expresses metalloendopeptidase activity. Sea urchin blastula proteins BP10 and SpAN. Caenorhabditis elegans hypothetical proteins F42A10.8 and R151.5. Neuropilin (A5 antigen), a calcium-independent cell adhesion molecule that functions during the formation of certain neuronal circuits. Fibropellins I and III from Strongylocentrotus purpuratus (Purple sea urchin). Mammalian hyaluronate-binding protein TSG-6 (or PS4), a serum and growth factor induced protein. Mammalian spermadhesins. Xenopus laevis embryonic protein UVS.2, which is expressed during dorsoanterior development. Several of the above proteins consist of a catalytic domain together with several CUB domains interspersed by calcium-binding EGF domains. Some CUB domains appear to be involved in oligomerisation and/or recognition of substrates and binding partners. For example, in the complement proteases, the CUB domains mediate dimerisation and binding to collagen-like regions of target proteins (e.g. C1q for C1r/C1s). The structure of CUB domains consists of a beta-sandwich with a jelly-roll fold. Almost all CUB domains contain four conserved cysteines that probably form two disulphide bridges (C1-C2, C3-C4). The CUB1 domains of C1s and Map19 have calcium-binding sites [].; PDB: 1SFP_A 3KQ4_B 2WNO_A 2QQK_A 2QQL_A 2QQO_B 2QQM_A 3POJ_A 3POB_A 3POG_B .... |
| >cd00041 CUB CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast | Back alignment and domain information |
|---|
| >smart00042 CUB Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein | Back alignment and domain information |
|---|
| >KOG4586|consensus | Back alignment and domain information |
|---|
| >PF00431 CUB: CUB domain CUB domain entry Spermadhesins family entry Link to schematic domain picture by Peer Bork | Back alignment and domain information |
|---|
| >cd00041 CUB CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast | Back alignment and domain information |
|---|
| >smart00042 CUB Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein | Back alignment and domain information |
|---|
| >KOG4292|consensus | Back alignment and domain information |
|---|
| >KOG4586|consensus | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >KOG4292|consensus | Back alignment and domain information |
|---|
| >PF05428 CRF-BP: Corticotropin-releasing factor binding protein (CRF-BP); InterPro: IPR008435 This family consists of several eukaryotic corticotropin-releasing factor binding proteins (CRF-BP or CRH-BP) | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >PF02408 CUB_2: CUB-like domain; InterPro: IPR003366 This domain is found in a family of hypothetical Caenorhabditis elegans proteins | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF05428 CRF-BP: Corticotropin-releasing factor binding protein (CRF-BP); InterPro: IPR008435 This family consists of several eukaryotic corticotropin-releasing factor binding proteins (CRF-BP or CRH-BP) | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 193 | ||||
| 2qqk_A | 579 | Neuropilin-2 A1a2b1b2 Domains In Complex With A Sem | 1e-20 | ||
| 2qqk_A | 579 | Neuropilin-2 A1a2b1b2 Domains In Complex With A Sem | 1e-05 | ||
| 3dem_A | 278 | Cub1-egf-cub2 Domain Of Human Masp-1/3 Length = 278 | 4e-20 | ||
| 3dem_A | 278 | Cub1-egf-cub2 Domain Of Human Masp-1/3 Length = 278 | 3e-06 | ||
| 4aqb_A | 361 | Mbl-Ficolin Associated Protein-1, Map-1 Aka Map44 L | 5e-20 | ||
| 4aqb_A | 361 | Mbl-Ficolin Associated Protein-1, Map-1 Aka Map44 L | 3e-06 | ||
| 1nt0_A | 286 | Crystal Structure Of The Cub1-Egf-Cub2 Region Of Ma | 1e-19 | ||
| 1nt0_A | 286 | Crystal Structure Of The Cub1-Egf-Cub2 Region Of Ma | 2e-06 | ||
| 3kq4_B | 457 | Structure Of Intrinsic Factor-Cobalamin Bound To It | 2e-13 | ||
| 3kq4_B | 457 | Structure Of Intrinsic Factor-Cobalamin Bound To It | 2e-05 | ||
| 4gz9_A | 577 | Mouse Neuropilin-1, Extracellular Domains 1-4 (A1a2 | 3e-13 | ||
| 4gz9_A | 577 | Mouse Neuropilin-1, Extracellular Domains 1-4 (A1a2 | 3e-06 | ||
| 1szb_A | 170 | Crystal Structure Of The Human Mbl-Associated Prote | 4e-12 | ||
| 1szb_A | 170 | Crystal Structure Of The Human Mbl-Associated Prote | 5e-08 | ||
| 2wno_A | 149 | X-Ray Structure Of Cub_c Domain From Tsg-6 Length = | 3e-09 | ||
| 2wno_A | 149 | X-Ray Structure Of Cub_c Domain From Tsg-6 Length = | 1e-05 | ||
| 2qqm_A | 450 | Crystal Structure Of The A2b1b2 Domains From Human | 1e-08 | ||
| 2qqm_A | 450 | Crystal Structure Of The A2b1b2 Domains From Human | 3e-04 | ||
| 2qqo_A | 460 | Crystal Structure Of The A2b1b2 Domains From Human | 3e-08 | ||
| 2qqo_A | 460 | Crystal Structure Of The A2b1b2 Domains From Human | 5e-07 | ||
| 1nzi_A | 159 | Crystal Structure Of The Cub1-Egf Interaction Domai | 4e-08 | ||
| 1nzi_A | 159 | Crystal Structure Of The Cub1-Egf Interaction Domai | 5e-04 | ||
| 4dg6_A | 616 | Crystal Structure Of Domains 1 And 2 Of Lrp6 Length | 1e-04 | ||
| 3s94_A | 619 | Crystal Structure Of Lrp6-E1e2 Length = 619 | 1e-04 | ||
| 3pob_A | 115 | Crystal Structure Of Masp-1 Cub2 Domain In Complex | 1e-04 | ||
| 3v65_B | 386 | Crystal Structure Of Agrin And Lrp4 Complex Length | 7e-04 |
| >pdb|2QQK|A Chain A, Neuropilin-2 A1a2b1b2 Domains In Complex With A Semaphorin-Blocking Fab Length = 579 | Back alignment and structure |
|
| >pdb|2QQK|A Chain A, Neuropilin-2 A1a2b1b2 Domains In Complex With A Semaphorin-Blocking Fab Length = 579 | Back alignment and structure |
| >pdb|3DEM|A Chain A, Cub1-egf-cub2 Domain Of Human Masp-1/3 Length = 278 | Back alignment and structure |
| >pdb|3DEM|A Chain A, Cub1-egf-cub2 Domain Of Human Masp-1/3 Length = 278 | Back alignment and structure |
| >pdb|4AQB|A Chain A, Mbl-Ficolin Associated Protein-1, Map-1 Aka Map44 Length = 361 | Back alignment and structure |
| >pdb|4AQB|A Chain A, Mbl-Ficolin Associated Protein-1, Map-1 Aka Map44 Length = 361 | Back alignment and structure |
| >pdb|1NT0|A Chain A, Crystal Structure Of The Cub1-Egf-Cub2 Region Of Masp2 Length = 286 | Back alignment and structure |
| >pdb|1NT0|A Chain A, Crystal Structure Of The Cub1-Egf-Cub2 Region Of Masp2 Length = 286 | Back alignment and structure |
| >pdb|3KQ4|B Chain B, Structure Of Intrinsic Factor-Cobalamin Bound To Its Receptor Cubilin Length = 457 | Back alignment and structure |
| >pdb|3KQ4|B Chain B, Structure Of Intrinsic Factor-Cobalamin Bound To Its Receptor Cubilin Length = 457 | Back alignment and structure |
| >pdb|4GZ9|A Chain A, Mouse Neuropilin-1, Extracellular Domains 1-4 (A1a2b1b2) Length = 577 | Back alignment and structure |
| >pdb|4GZ9|A Chain A, Mouse Neuropilin-1, Extracellular Domains 1-4 (A1a2b1b2) Length = 577 | Back alignment and structure |
| >pdb|1SZB|A Chain A, Crystal Structure Of The Human Mbl-Associated Protein 19 (Map19) Length = 170 | Back alignment and structure |
| >pdb|1SZB|A Chain A, Crystal Structure Of The Human Mbl-Associated Protein 19 (Map19) Length = 170 | Back alignment and structure |
| >pdb|2WNO|A Chain A, X-Ray Structure Of Cub_c Domain From Tsg-6 Length = 149 | Back alignment and structure |
| >pdb|2WNO|A Chain A, X-Ray Structure Of Cub_c Domain From Tsg-6 Length = 149 | Back alignment and structure |
| >pdb|2QQM|A Chain A, Crystal Structure Of The A2b1b2 Domains From Human Neuropilin-1 Length = 450 | Back alignment and structure |
| >pdb|2QQM|A Chain A, Crystal Structure Of The A2b1b2 Domains From Human Neuropilin-1 Length = 450 | Back alignment and structure |
| >pdb|2QQO|A Chain A, Crystal Structure Of The A2b1b2 Domains From Human Neuropilin-2 Length = 460 | Back alignment and structure |
| >pdb|2QQO|A Chain A, Crystal Structure Of The A2b1b2 Domains From Human Neuropilin-2 Length = 460 | Back alignment and structure |
| >pdb|1NZI|A Chain A, Crystal Structure Of The Cub1-Egf Interaction Domain Of Complement Protease C1s Length = 159 | Back alignment and structure |
| >pdb|1NZI|A Chain A, Crystal Structure Of The Cub1-Egf Interaction Domain Of Complement Protease C1s Length = 159 | Back alignment and structure |
| >pdb|4DG6|A Chain A, Crystal Structure Of Domains 1 And 2 Of Lrp6 Length = 616 | Back alignment and structure |
| >pdb|3S94|A Chain A, Crystal Structure Of Lrp6-E1e2 Length = 619 | Back alignment and structure |
| >pdb|3POB|A Chain A, Crystal Structure Of Masp-1 Cub2 Domain In Complex With The Collagen- Like Domain Of Mbl Length = 115 | Back alignment and structure |
| >pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 193 | |||
| 2qqk_A | 579 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 1e-52 | |
| 2qqk_A | 579 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 8e-21 | |
| 2qqk_A | 579 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 2e-15 | |
| 3dem_A | 278 | Complement factor MAsp-3; complement system, innat | 4e-51 | |
| 3dem_A | 278 | Complement factor MAsp-3; complement system, innat | 8e-20 | |
| 3dem_A | 278 | Complement factor MAsp-3; complement system, innat | 3e-19 | |
| 1nt0_A | 286 | MAsp2, mannose-binding protein associated serine p | 2e-49 | |
| 1nt0_A | 286 | MAsp2, mannose-binding protein associated serine p | 2e-19 | |
| 1nt0_A | 286 | MAsp2, mannose-binding protein associated serine p | 4e-17 | |
| 4aqb_A | 361 | Mannan-binding lectin serine protease 1; blood clo | 1e-48 | |
| 4aqb_A | 361 | Mannan-binding lectin serine protease 1; blood clo | 1e-23 | |
| 4aqb_A | 361 | Mannan-binding lectin serine protease 1; blood clo | 8e-17 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 6e-41 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 5e-39 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 8e-39 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 4e-19 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 1e-18 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 2e-38 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 1e-17 | |
| 2wno_A | 149 | Tumor necrosis factor-inducible gene 6 protein; gl | 3e-34 | |
| 2wno_A | 149 | Tumor necrosis factor-inducible gene 6 protein; gl | 2e-21 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 6e-33 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 3e-19 | |
| 2qqm_A | 450 | Neuropilin-1; VEGF receptor, semaphorin receptor, | 7e-27 | |
| 2qqm_A | 450 | Neuropilin-1; VEGF receptor, semaphorin receptor, | 3e-22 | |
| 2qqo_A | 460 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 1e-25 | |
| 2qqo_A | 460 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 1e-21 | |
| 1sfp_A | 114 | ASFP; spermadhesin, bovine seminal plasma protein, | 2e-24 | |
| 1sfp_A | 114 | ASFP; spermadhesin, bovine seminal plasma protein, | 5e-16 | |
| 3poj_A | 115 | Mannan-binding lectin serine protease 1; CUB domai | 8e-24 | |
| 3poj_A | 115 | Mannan-binding lectin serine protease 1; CUB domai | 1e-18 | |
| 1spp_B | 116 | Major seminal plasma glycoprotein PSP-II; seminal | 6e-21 | |
| 1spp_B | 116 | Major seminal plasma glycoprotein PSP-II; seminal | 3e-17 | |
| 1spp_A | 109 | Major seminal plasma glycoprotein PSP-I; seminal p | 1e-19 | |
| 1spp_A | 109 | Major seminal plasma glycoprotein PSP-I; seminal p | 6e-18 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 9e-13 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 3e-10 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 2e-12 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 2e-12 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 1e-11 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 3e-11 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 2e-10 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 3e-11 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 3e-09 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 2e-08 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 3e-06 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 6e-11 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 3e-09 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 8e-11 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 3e-10 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 2e-09 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 3e-04 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 3e-04 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 3e-09 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 7e-09 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 3e-09 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 3e-09 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 3e-09 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 4e-09 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 6e-09 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 4e-05 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 5e-08 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 2e-06 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 5e-06 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 2e-07 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 6e-05 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 9e-07 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 4e-06 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 8e-06 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 6e-05 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 7e-05 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 7e-05 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 1e-04 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 1e-04 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 2e-04 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 7e-04 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 8e-04 |
| >2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Length = 579 | Back alignment and structure |
|---|
Score = 175 bits (446), Expect = 1e-52
Identities = 57/191 (29%), Positives = 80/191 (41%), Gaps = 38/191 (19%)
Query: 1 VALKFQSFEIENHDQCTYDYVEIRDGHAPDSPIIGTYCGYKLPPDIKSSGTKLMIKFVSD 60
+ L F C YD++EIRDG + + ++G +CG PP I SSG+ L IKF SD
Sbjct: 46 IVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSD 105
Query: 61 GSVQKPGFSAIFMKEFDECALEDHGCEHTCKNILGGYECSCKIGYELHSDGKICLDACGG 120
+ Q GFS + K + C
Sbjct: 106 YARQGAGFSLRY------------------------------------EIFKTGSEDCSK 129
Query: 121 ILNTPNGTLTSPSFPDLYIKNKTCIWEIVAPPQYRISLNFTHFDIEGNNLFQSS--CEYD 178
+PNGT+ SP FP+ Y N C + I+A P+ I L F FD+E + L C+YD
Sbjct: 130 NFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCKYD 189
Query: 179 NLTVFSKIGDS 189
L ++ I
Sbjct: 190 WLDIWDGIPHV 200
|
| >2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Length = 579 | Back alignment and structure |
|---|
| >2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Length = 579 | Back alignment and structure |
|---|
| >3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Length = 286 | Back alignment and structure |
|---|
| >1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Length = 286 | Back alignment and structure |
|---|
| >1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Length = 286 | Back alignment and structure |
|---|
| >4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 | Back alignment and structure |
|---|
| >4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 | Back alignment and structure |
|---|
| >4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 | Back alignment and structure |
|---|
| >2wno_A Tumor necrosis factor-inducible gene 6 protein; glycoprotein, cell adhesion, extracellular matrix; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2wno_A Tumor necrosis factor-inducible gene 6 protein; glycoprotein, cell adhesion, extracellular matrix; 2.30A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 170 | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 170 | Back alignment and structure |
|---|
| >2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Length = 450 | Back alignment and structure |
|---|
| >2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Length = 450 | Back alignment and structure |
|---|
| >2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Length = 460 | Back alignment and structure |
|---|
| >2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Length = 460 | Back alignment and structure |
|---|
| >1sfp_A ASFP; spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, CUB domain, X-RAY growth factor; 1.90A {Bos taurus} SCOP: b.23.1.1 Length = 114 | Back alignment and structure |
|---|
| >1sfp_A ASFP; spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, CUB domain, X-RAY growth factor; 1.90A {Bos taurus} SCOP: b.23.1.1 Length = 114 | Back alignment and structure |
|---|
| >3poj_A Mannan-binding lectin serine protease 1; CUB domain, Ca2+ binding site, complex with ethylamine, COMP protein, lectin pathway of complement; 1.45A {Rattus norvegicus} PDB: 3pob_A 3pof_A 3pog_A 3poi_A 3poe_A Length = 115 | Back alignment and structure |
|---|
| >3poj_A Mannan-binding lectin serine protease 1; CUB domain, Ca2+ binding site, complex with ethylamine, COMP protein, lectin pathway of complement; 1.45A {Rattus norvegicus} PDB: 3pob_A 3pof_A 3pog_A 3poi_A 3poe_A Length = 115 | Back alignment and structure |
|---|
| >1spp_B Major seminal plasma glycoprotein PSP-II; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Length = 116 | Back alignment and structure |
|---|
| >1spp_B Major seminal plasma glycoprotein PSP-II; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Length = 116 | Back alignment and structure |
|---|
| >1spp_A Major seminal plasma glycoprotein PSP-I; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Length = 109 | Back alignment and structure |
|---|
| >1spp_A Major seminal plasma glycoprotein PSP-I; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Length = 109 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| 3dem_A | 278 | Complement factor MAsp-3; complement system, innat | 100.0 | |
| 1nt0_A | 286 | MAsp2, mannose-binding protein associated serine p | 100.0 | |
| 4aqb_A | 361 | Mannan-binding lectin serine protease 1; blood clo | 100.0 | |
| 4gz9_A | 577 | Neuropilin-1, A5 protein; multi-domain, cell-CELL | 100.0 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 100.0 | |
| 3kq4_B | 457 | Cubilin; protein-protein complex, cobalt, cobalt t | 100.0 | |
| 2qqk_A | 579 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 100.0 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 99.91 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 99.89 | |
| 2wno_A | 149 | Tumor necrosis factor-inducible gene 6 protein; gl | 99.86 | |
| 3poj_A | 115 | Mannan-binding lectin serine protease 1; CUB domai | 99.81 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 99.8 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 99.79 | |
| 2wno_A | 149 | Tumor necrosis factor-inducible gene 6 protein; gl | 99.79 | |
| 4aqb_A | 361 | Mannan-binding lectin serine protease 1; blood clo | 99.74 | |
| 2qqo_A | 460 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 99.72 | |
| 3dem_A | 278 | Complement factor MAsp-3; complement system, innat | 99.72 | |
| 2qqm_A | 450 | Neuropilin-1; VEGF receptor, semaphorin receptor, | 99.72 | |
| 1spp_A | 109 | Major seminal plasma glycoprotein PSP-I; seminal p | 99.71 | |
| 1nt0_A | 286 | MAsp2, mannose-binding protein associated serine p | 99.71 | |
| 1spp_B | 116 | Major seminal plasma glycoprotein PSP-II; seminal | 99.68 | |
| 1sfp_A | 114 | ASFP; spermadhesin, bovine seminal plasma protein, | 99.67 | |
| 3poj_A | 115 | Mannan-binding lectin serine protease 1; CUB domai | 99.65 | |
| 1spp_B | 116 | Major seminal plasma glycoprotein PSP-II; seminal | 99.64 | |
| 2qqo_A | 460 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 99.64 | |
| 1sfp_A | 114 | ASFP; spermadhesin, bovine seminal plasma protein, | 99.64 | |
| 2qqm_A | 450 | Neuropilin-1; VEGF receptor, semaphorin receptor, | 99.63 | |
| 4gz9_A | 577 | Neuropilin-1, A5 protein; multi-domain, cell-CELL | 99.63 | |
| 1spp_A | 109 | Major seminal plasma glycoprotein PSP-I; seminal p | 99.62 | |
| 2qqk_A | 579 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 99.6 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 98.21 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 98.17 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 98.02 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 98.02 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 98.0 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 97.96 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.37 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 97.33 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 96.96 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 96.8 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 96.75 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 96.68 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 96.68 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 96.68 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 96.62 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 96.44 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 96.43 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 96.4 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 96.38 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 96.35 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 96.35 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 96.27 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 96.17 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 96.16 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 96.09 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 95.85 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 95.83 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 95.68 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 95.63 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 95.2 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 95.01 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 94.88 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 94.72 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 94.72 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 94.46 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 94.41 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 94.02 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 93.93 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 93.74 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 93.47 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 92.91 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 92.68 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 92.61 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 92.16 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 91.89 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 91.65 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 89.94 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 89.84 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 88.94 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 88.05 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 86.41 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 85.37 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 84.86 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 84.79 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 84.5 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 83.29 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 82.76 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 81.15 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 81.09 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 80.59 |
| >3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.6e-42 Score=260.13 Aligned_cols=181 Identities=34% Similarity=0.753 Sum_probs=161.0
Q ss_pred CEEEeeEEeecCCCCCCCcEEEEEeCCCCCCCcccCccCccCC--------CceEecCCEEEEEEecCCCCCC--CCceE
Q psy11864 1 VALKFQSFEIENHDQCTYDYVEIRDGHAPDSPIIGTYCGYKLP--------PDIKSSGTKLMIKFVSDGSVQK--PGFSA 70 (193)
Q Consensus 1 I~l~F~~f~le~~~~C~~d~l~v~dg~~~~~~~~~~~cg~~~p--------~~i~s~~~~l~v~f~sd~~~~~--~GF~~ 70 (193)
|+|+|.+|+||.+..|.+|||+|+||. ..++++||...| ..++|+++.|+|+|++|.+... .||+|
T Consensus 39 I~L~F~~f~le~~~~C~~D~l~v~dg~----~~~~~~CG~~~~~~~~~~~~~~~~S~~n~l~v~F~Sd~~~~~~~~GF~~ 114 (278)
T 3dem_A 39 IKLYFMHFNLESSYLCEYDYVKVETED----QVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDA 114 (278)
T ss_dssp EEEEEEEEECCCCGGGCSSEEEEECSS----CEEEEECSBSSSSSSCCCTTCCEECSSSEEEEEEEECSCCCSCCCEEEE
T ss_pred EEEEEEEEEeCCCCCCCCcEEEEecCC----cccceEcCCcCCCcccCCCCccEEecCCeEEEEEecCcccccccceeEE
Confidence 689999999999889999999999974 468999998753 6899999999999999988764 79999
Q ss_pred eccc-ccccccCCC---CCccceeecCCCceEEeccCCeEEccCCcccccCCCCC-cccCCCCccCCCCCCCCCCCCceE
Q psy11864 71 IFMK-EFDECALED---HGCEHTCKNILGGYECSCKIGYELHSDGKICLDACGGI-LNTPNGTLTSPSFPDLYIKNKTCI 145 (193)
Q Consensus 71 ~~~~-~~~~c~~~~---~~c~~~c~~~~~~~~c~c~~g~~l~~~~~~C~~~C~~~-~~~~~g~i~Sp~~p~~y~~~~~C~ 145 (193)
.|.+ ..++|.... ..|.+.|.+..+++.|.|.+||.++.+.+.|...|++. ++..+|.|+||+||.+||++.+|.
T Consensus 115 ~y~~~~~~~C~~~~~~~~~c~~~C~n~~g~~~C~C~~Gy~l~~d~~~C~~~Cgg~~~~~~~G~i~SP~yP~~Yp~~~~C~ 194 (278)
T 3dem_A 115 HYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECL 194 (278)
T ss_dssp EEEEEECCTTTC-----CCCSSEEEEETTEEEEECCTTCEECTTSSCEECCCCCCCBCSSEEEEESTTTTSCCCSSCEEE
T ss_pred EEEEeccccCCCCCCCcccCCcCcCCccCCcEEEeCCcceeccCCCCCcccCCCceecCCccceeCCCCCCCCCCcCeEE
Confidence 9987 567787654 37999999999999999999999999999999999985 588899999999999999999999
Q ss_pred EEEEcCCCCeEEEEEee-EEeecCCCCCCCCCCcEEEEEeCCC
Q psy11864 146 WEIVAPPQYRISLNFTH-FDIEGNNLFQSSCEYDNLTVFSKIG 187 (193)
Q Consensus 146 w~I~~~~~~~i~l~F~~-f~l~~~~~~~~~C~~D~l~I~dg~~ 187 (193)
|.|+++++++|.|+|.+ |+||... ...|.+|||+||||..
T Consensus 195 w~i~~~~g~~i~l~f~~~f~le~~~--~~~C~~D~l~i~dg~~ 235 (278)
T 3dem_A 195 YTIELEEGFMVNLQFEDIFDIEDHP--EVPCPYDYIKIKVGPK 235 (278)
T ss_dssp EEEECCTTCCEEEEECSCCBBCCCS--SSSSSSCEEEEEETTE
T ss_pred EEEEeCCCcEEEEEEccccccccCC--CCCCCCCEEEEecCCc
Confidence 99999999999999997 9999642 2479999999999963
|
| >1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2wno_A Tumor necrosis factor-inducible gene 6 protein; glycoprotein, cell adhesion, extracellular matrix; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3poj_A Mannan-binding lectin serine protease 1; CUB domain, Ca2+ binding site, complex with ethylamine, COMP protein, lectin pathway of complement; 1.45A {Rattus norvegicus} PDB: 3pob_A 3pof_A 3pog_A 3poi_A 3poe_A | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2wno_A Tumor necrosis factor-inducible gene 6 protein; glycoprotein, cell adhesion, extracellular matrix; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 | Back alignment and structure |
|---|
| >1spp_A Major seminal plasma glycoprotein PSP-I; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 | Back alignment and structure |
|---|
| >1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1spp_B Major seminal plasma glycoprotein PSP-II; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 | Back alignment and structure |
|---|
| >1sfp_A ASFP; spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, CUB domain, X-RAY growth factor; 1.90A {Bos taurus} SCOP: b.23.1.1 | Back alignment and structure |
|---|
| >3poj_A Mannan-binding lectin serine protease 1; CUB domain, Ca2+ binding site, complex with ethylamine, COMP protein, lectin pathway of complement; 1.45A {Rattus norvegicus} PDB: 3pob_A 3pof_A 3pog_A 3poi_A 3poe_A | Back alignment and structure |
|---|
| >1spp_B Major seminal plasma glycoprotein PSP-II; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 | Back alignment and structure |
|---|
| >2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1sfp_A ASFP; spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, CUB domain, X-RAY growth factor; 1.90A {Bos taurus} SCOP: b.23.1.1 | Back alignment and structure |
|---|
| >2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 | Back alignment and structure |
|---|
| >4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H | Back alignment and structure |
|---|
| >1spp_A Major seminal plasma glycoprotein PSP-I; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 | Back alignment and structure |
|---|
| >2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 193 | ||||
| d1uzka1 | 43 | g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa | 6e-12 | |
| d1szba2 | 45 | g.3.11.1 (A:124-168) Mannose-binding protein assoc | 7e-12 | |
| d1kigl_ | 51 | g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo | 8e-12 | |
| d1i0ua2 | 41 | g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r | 8e-12 | |
| d2qqma3 | 108 | b.23.1.1 (A:156-263) Mannose-binding protein assoc | 1e-11 | |
| d2qqma3 | 108 | b.23.1.1 (A:156-263) Mannose-binding protein assoc | 1e-09 | |
| d1autl2 | 50 | g.3.11.1 (L:97-146) Activated protein c (autoproth | 3e-11 | |
| d2p3ua1 | 51 | g.3.11.1 (A:87-137) Factor X, N-terminal module {H | 4e-11 | |
| d3bpse1 | 40 | g.3.11.1 (E:293-332) Low density lipoprotein (LDL) | 6e-11 | |
| d1nzia2 | 42 | g.3.11.1 (A:118-159) Complement C1S component {Hum | 1e-10 | |
| d1lmja2 | 42 | g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien | 2e-10 | |
| d1nt0a3 | 45 | g.3.11.1 (A:120-164) Mannose-binding protein assoc | 2e-10 | |
| d1uzka2 | 43 | g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa | 4e-10 | |
| d2bz6l1 | 53 | g.3.11.1 (L:90-142) Coagulation factor VIIa {Human | 6e-10 | |
| d1apqa_ | 53 | g.3.11.1 (A:) Complement protease C1R {Human (Homo | 7e-10 | |
| d1ijqa2 | 50 | g.3.11.1 (A:643-692) Low density lipoprotein (LDL) | 9e-10 | |
| d1rfnb_ | 57 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 1e-09 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 5e-09 | |
| d1nt0a2 | 114 | b.23.1.1 (A:165-278) Mannose-binding protein assoc | 6e-09 | |
| d1nt0a2 | 114 | b.23.1.1 (A:165-278) Mannose-binding protein assoc | 3e-08 | |
| d1szba1 | 121 | b.23.1.1 (A:3-123) Mannose-binding protein associa | 7e-09 | |
| d1szba1 | 121 | b.23.1.1 (A:3-123) Mannose-binding protein associa | 3e-07 | |
| d1nzia1 | 117 | b.23.1.1 (A:1-117) Complement C1S component {Human | 1e-08 | |
| d1nzia1 | 117 | b.23.1.1 (A:1-117) Complement C1S component {Human | 9e-07 | |
| d1dx5i3 | 40 | g.3.11.1 (I:423-462) Thrombomodulin, different EGF | 4e-08 | |
| d1lmja1 | 44 | g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens | 6e-08 | |
| d1sppb_ | 112 | b.23.1.1 (B:) Major seminal plasma glycoprotein PS | 2e-07 | |
| d1sppb_ | 112 | b.23.1.1 (B:) Major seminal plasma glycoprotein PS | 0.004 | |
| d1sppa_ | 109 | b.23.1.1 (A:) Major seminal plasma glycoprotein PS | 5e-06 | |
| d1sfpa_ | 111 | b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) | 9e-06 | |
| d1sfpa_ | 111 | b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) | 6e-05 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 4e-05 | |
| d1gl4a2 | 40 | g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 | 4e-04 | |
| d1emoa2 | 39 | g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sa | 6e-04 |
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Fibrillin-1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 56.0 bits (135), Expect = 6e-12
Identities = 12/40 (30%), Positives = 16/40 (40%)
Query: 77 DECALEDHGCEHTCKNILGGYECSCKIGYELHSDGKICLD 116
+EC C N G Y C C +EL+ C+D
Sbjct: 4 NECLDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVD 43
|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 114 | Back information, alignment and structure |
|---|
| >d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 114 | Back information, alignment and structure |
|---|
| >d1szba1 b.23.1.1 (A:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 121 | Back information, alignment and structure |
|---|
| >d1szba1 b.23.1.1 (A:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 121 | Back information, alignment and structure |
|---|
| >d1nzia1 b.23.1.1 (A:1-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1nzia1 b.23.1.1 (A:1-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1sppb_ b.23.1.1 (B:) Major seminal plasma glycoprotein PSP-II {Pig (Sus scrofa) [TaxId: 9823]} Length = 112 | Back information, alignment and structure |
|---|
| >d1sppb_ b.23.1.1 (B:) Major seminal plasma glycoprotein PSP-II {Pig (Sus scrofa) [TaxId: 9823]} Length = 112 | Back information, alignment and structure |
|---|
| >d1sppa_ b.23.1.1 (A:) Major seminal plasma glycoprotein PSP-I {Pig (Sus scrofa) [TaxId: 9823]} Length = 109 | Back information, alignment and structure |
|---|
| >d1sfpa_ b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) {Cow (Bos taurus) [TaxId: 9913]} Length = 111 | Back information, alignment and structure |
|---|
| >d1sfpa_ b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) {Cow (Bos taurus) [TaxId: 9913]} Length = 111 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| d1szba1 | 121 | Mannose-binding protein associated serine protease | 99.82 | |
| d1nzia1 | 117 | Complement C1S component {Human (Homo sapiens) [Ta | 99.81 | |
| d2qqma3 | 108 | Mannose-binding protein associated serine protease | 99.79 | |
| d1nt0a2 | 114 | Mannose-binding protein associated serine protease | 99.77 | |
| d2qqma3 | 108 | Mannose-binding protein associated serine protease | 99.71 | |
| d1sppb_ | 112 | Major seminal plasma glycoprotein PSP-II {Pig (Sus | 99.69 | |
| d1sppa_ | 109 | Major seminal plasma glycoprotein PSP-I {Pig (Sus | 99.66 | |
| d1nzia1 | 117 | Complement C1S component {Human (Homo sapiens) [Ta | 99.59 | |
| d1sfpa_ | 111 | Acidic seminal fluid protein (ASFP) {Cow (Bos taur | 99.58 | |
| d1szba1 | 121 | Mannose-binding protein associated serine protease | 99.54 | |
| d1nt0a2 | 114 | Mannose-binding protein associated serine protease | 99.51 | |
| d1sppb_ | 112 | Major seminal plasma glycoprotein PSP-II {Pig (Sus | 99.49 | |
| d1sfpa_ | 111 | Acidic seminal fluid protein (ASFP) {Cow (Bos taur | 99.44 | |
| d1sppa_ | 109 | Major seminal plasma glycoprotein PSP-I {Pig (Sus | 99.4 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.58 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 98.54 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 98.54 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 98.53 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 98.53 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 98.51 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 98.44 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 98.43 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 98.35 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 98.31 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.27 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.26 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 98.23 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.15 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 98.14 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.08 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.96 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 97.93 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.69 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 95.49 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 95.06 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 94.74 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 94.14 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.49 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 93.27 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 93.26 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 90.17 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 89.89 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 87.4 |
| >d1szba1 b.23.1.1 (A:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: CUB-like superfamily: Spermadhesin, CUB domain family: Spermadhesin, CUB domain domain: Mannose-binding protein associated serine protease 2, MASP2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.82 E-value=9.4e-21 Score=123.68 Aligned_cols=64 Identities=39% Similarity=0.696 Sum_probs=58.5
Q ss_pred ccCCCCccCCCCCCCCCCCCceEEEEEcCCCCeEEEEEeeEEeecCCCCCCCCCCcEEEEEeCCCCcc
Q psy11864 123 NTPNGTLTSPSFPDLYIKNKTCIWEIVAPPQYRISLNFTHFDIEGNNLFQSSCEYDNLTVFSKIGDSF 190 (193)
Q Consensus 123 ~~~~g~i~Sp~~p~~y~~~~~C~w~I~~~~~~~i~l~F~~f~l~~~~~~~~~C~~D~l~I~dg~~~~~ 190 (193)
....|.|+||+||..||++.+|.|+|.+|++++|.|+|.+|+||... .|.+|+|+|+||.....
T Consensus 7 ~~~~G~i~SP~yP~~Yp~~~~C~W~I~~p~g~~I~l~f~~fdle~~~----~C~~D~l~i~dg~~~~~ 70 (121)
T d1szba1 7 EPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSH----LCEYDFVKLSSGAKVLA 70 (121)
T ss_dssp CCCEEEEECTTTTSCCCSSCEEEEEEECCTTEEEEEEEEEEECCCCT----TSCSSEEEEESSSSEEE
T ss_pred CCCCeEEeCCCCCCCCCCCCeEEEEEEeCCCceeEEEeeeeeeeeec----cccccceeeecCCcccc
Confidence 34579999999999999999999999999999999999999999875 89999999999977544
|
| >d1nzia1 b.23.1.1 (A:1-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sppb_ b.23.1.1 (B:) Major seminal plasma glycoprotein PSP-II {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1sppa_ b.23.1.1 (A:) Major seminal plasma glycoprotein PSP-I {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nzia1 b.23.1.1 (A:1-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sfpa_ b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1szba1 b.23.1.1 (A:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sppb_ b.23.1.1 (B:) Major seminal plasma glycoprotein PSP-II {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1sfpa_ b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sppa_ b.23.1.1 (A:) Major seminal plasma glycoprotein PSP-I {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|