Diaphorina citri psyllid: psy11898

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MIKIMLVRMGTDRSFLSLEFSFHRALDPESGRYMEVHTDQPGIQFYTGNYIPEMSGKKGATYTKHCAYCFETQNFPNAVNIHRSSWGKIQTCGVLFIWSSADFVNCKPYSSEKPIGQIKRMIPT
ccEEEcccccccCEEccccccEEEEEccccccEEEEEEccccEEEEccccccccccccccEEcccCEEEEccccccccccccccccccEEEcccEEEEEEEEEEEEEEcccccccccccccccc
MIKIMLVRMGTDRSFLSLEFSFHRALDPESGRYMEVHTDQPGIQFYTGNYIPEMSGKKGATYTKHCAYCFETQNFPNAVNIHRSSWGKIQTCGVLFIWSSADFVNCKPYS*****GQIKRMIP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKIMLVRMGTDRSFLSLEFSFHRALDPESGRYMEVHTDQPGIQFYTGNYIPEMSGKKGATYTKHCAYCFETQNFPNAVNIHRSSWGKIQTCGVLFIWSSADFVNCKPYSSEKPIGQIKRMIPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aldose 1-epimerase Mutarotase converts alpha-aldose to the beta-anomer. It is active on D-glucose, L-arabinose, D-xylose, D-galactose, maltose and lactose.confidentQ5R8U1
Aldose 1-epimerase Mutarotase converts alpha-aldose to the beta-anomer. It is active on D-glucose, L-arabinose, D-xylose, D-galactose, maltose and lactose.confidentQ5EA79
Aldose 1-epimerase Mutarotase converts alpha-aldose to the beta-anomer. It is active on D-glucose, L-arabinose, D-xylose, D-galactose, maltose and lactose.confidentQ9GKX6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048046 [CC]apoplastprobableGO:0005575, GO:0005576
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SNZ, chain A
Confidence level:very confident
Coverage over the Query: 10-106
View the alignment between query and template
View the model in PyMOL